DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and DUSP14

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_008957.1 Gene:DUSP14 / 11072 HGNCID:17007 Length:198 Species:Homo sapiens


Alignment Length:223 Identity:63/223 - (28%)
Similarity:84/223 - (37%) Gaps:53/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 AEMLVILGQMDAPTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVY 437
            |..::..|.:....:|...::||....|||...||..|:..|:|.|.||.||....|||..|.:.
Human    15 APRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLA 79

  Fly   438 DDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMK--------AYQWEFQQ 494
            |.....:..|:|.....|.....:....||||..||||||::.|||.||        ||.|    
Human    80 DMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNW---- 140

  Fly   495 ALEHVKKRRSCIKPNKNFLNQLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLI 559
                ||.||..|:||..|..||..|.                           |.|.|.....::
Human   141 ----VKARRPVIRPNVGFWRQLIDYE---------------------------RQLFGKSTVKMV 174

  Fly   560 QALNQAKSKSTGEAGVTPDGEEEDGSRM 587
            |.          ..|:.||..|::...:
Human   175 QT----------PYGIVPDVYEKESRHL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 1/5 (20%)
DSPc 385..519 CDD:238073 52/141 (37%)
DUSP14NP_008957.1 DUSP14 20..169 CDD:350420 57/183 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.