DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Styx

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001258470.1 Gene:Styx / 100912536 RGDID:1594806 Length:223 Species:Rattus norvegicus


Alignment Length:218 Identity:61/218 - (27%)
Similarity:107/218 - (49%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 IKMKLKAIMMSVDLDEVTSKYIRGRLEEIL-DMDLGEYKSFIDAEMLVILGQMDAPTKIFEHVYL 394
            :|::..::....|..|..:..:|..::|:| .:.||.|.|.:                       
  Rat     4 VKLEFPSLPQCKDDAEEWTYPMRREMQEVLPGLFLGPYSSAM----------------------- 45

  Fly   395 GSEWNASNLEELQKNGVRHILNVTREID-NF----FPGTFEYFNVRVYDDEKTNLLKYWDDTFRY 454
                 .|.|..|||:|:.||:.:.:.|: ||    |...|.|..:.:.|:...|:::::..|..:
  Rat    46 -----KSKLPILQKHGITHIICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEF 105

  Fly   455 ITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETY 519
            |..:...|.|||||...|:||||:.||||.|:.:..:::.|..:|::||.||.||..|::||:.|
  Rat   106 IDGSLQNGGKVLVHGNAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEY 170

  Fly   520 SGMLDA-----MKNKEKLQRSKS 537
            ..:..|     |.:..:::||.|
  Rat   171 EAIYLAKLTIQMMSPLQIERSLS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 10/48 (21%)
DSPc 385..519 CDD:238073 45/138 (33%)
StyxNP_001258470.1 DSP_STYX 25..175 CDD:350372 53/177 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.