DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and epm2a

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_005170620.1 Gene:epm2a / 100535304 ZFINID:ZDB-GENE-100922-143 Length:322 Species:Danio rerio


Alignment Length:204 Identity:43/204 - (21%)
Similarity:74/204 - (36%) Gaps:62/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 TKIFEHVYLGS---EWNASNLEELQKNGVRHILNVTRE---IDNFF--------PGTFEYFNVRV 436
            :::...|:|||   ......|:..|:.||..::|...|   |:|..        |.|.|.. :.:
Zfish   141 SQVLPRVWLGSCPRRVEHVTLKLKQELGVTAVMNFQTEWDVINNSHGCRRDLSQPMTPETM-MHL 204

  Fly   437 YDDEKTNLLKYWDDTFRYITRAKAE---------------GSKVLVHCKMGVSRSASVVIAYAMK 486
            |.|  :.|...|..|....|..:.:               |..|.|||..||.||.:.|....|.
Zfish   205 YRD--SGLSYIWMPTQDMSTEGRIQMLPQAVFLLFGLLENGHSVYVHCNAGVGRSTAAVCGLLMY 267

  Fly   487 AYQWEFQQALEHVKKRRSCIKPNKNFLNQLETYSGMLDAMKNKEKLQRSKSETNLK--------- 542
            .:.|:.::....:..||:.:               .:|    :|.|.|::.:.::|         
Zfish   268 VFGWKLRKVQYFLTARRAAV---------------YID----EEALLRARDDFHMKFGQLCPSVR 313

  Fly   543 --STKDARL 549
              .|:|:.|
Zfish   314 NTETQDSTL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 35/161 (22%)
epm2aXP_005170620.1 CBM20_laforin 3..112 CDD:99881
PTPc 141..288 CDD:304379 35/164 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.