DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp26

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_002933015.2 Gene:dusp26 / 100493443 XenbaseID:XB-GENE-950157 Length:190 Species:Xenopus tropicalis


Alignment Length:166 Identity:52/166 - (31%)
Similarity:88/166 - (53%) Gaps:15/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 GEYK-------SFIDAEMLVILGQM--DAPTKIFEHVYLGSEWNASNLEELQKNGVRHILNVT-- 418
            |:||       |..:.|.|:..|:|  ....:::.::|||.:..|::..||.:..:.||||..  
 Frog    15 GKYKISRHNALSVFELEKLLYTGKMIKQHADEVWPNLYLGDQDIAADKGELLRLNITHILNACHS 79

  Fly   419 --REIDNFFPG-TFEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVV 480
              |..::::.| ...|..:..:|.|..::..::.....:|.:|.....|:||||.:||||||::|
 Frog    80 RFRGGEDYYKGMNISYMGIEAHDSEIFDMSIHFYPAADFIHKALRGRGKILVHCAVGVSRSATLV 144

  Fly   481 IAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQL 516
            :||.|..:.....:|:..||:||..| ||:.||.||
 Frog   145 LAYLMIHHNMTLVEAITTVKERRGII-PNRGFLRQL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 6/20 (30%)
DSPc 385..519 CDD:238073 44/137 (32%)
dusp26XP_002933015.2 DUSP26 44..186 CDD:350426 44/137 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.