DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp18

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_002931751.1 Gene:dusp18 / 100491030 XenbaseID:XB-GENE-1018365 Length:187 Species:Xenopus tropicalis


Alignment Length:132 Identity:48/132 - (36%)
Similarity:66/132 - (50%) Gaps:0/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 IFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDDTF 452
            |.|.:||.|...|.|...|..:.:..::||:.|||.......||.::.|.|...|.||:|:||..
 Frog    22 ISEGLYLASAKAARNRTLLATHCITCVINVSLEIDKNESPELEYVHIPVPDTPDTCLLQYFDDIA 86

  Fly   453 RYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLE 517
            ..|...|..|...|:||..|:|||.::.:||.||.:......|...||..|..|:||..|..||.
 Frog    87 DKIHNIKVSGGSTLLHCVAGISRSPTLCLAYLMKYHSLSLLAAHARVKMCRPIIRPNLGFWKQLM 151

  Fly   518 TY 519
            :|
 Frog   152 SY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 47/130 (36%)
dusp18XP_002931751.1 PTP_DSP_cys 18..175 CDD:391942 48/132 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.