DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp22a

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_002936144.2 Gene:dusp22a / 100485576 XenbaseID:XB-GENE-5831311 Length:209 Species:Xenopus tropicalis


Alignment Length:202 Identity:55/202 - (27%)
Similarity:93/202 - (46%) Gaps:36/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 TKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFE--YFNVRVYDDEKTNLLKYW 448
            |||.:.:|||:..::.:...|.:||:|||::|.   :|..|...|  |..:...|....||::::
 Frog     6 TKIVDGLYLGNIRDSEDKATLNRNGIRHIVSVH---NNAKPLLQEMTYLCISASDSSSQNLIQHF 67

  Fly   449 DDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFL 513
            ....::|...:..|...||||..|||||.::::||.|....:.:.:.|..|:..||.:.||..|.
 Frog    68 KQCIKFIHECRLHGGGCLVHCLAGVSRSTTILVAYLMTVTNFGWDECLSAVRSVRSYVGPNFGFQ 132

  Fly   514 NQLETYSGML--------------DAMKNKEKLQR--SKSETNLKSTKDARLLPGSEPTPLIQAL 562
            .||:.|...|              :...:::|:|:  :|.|               |...|.|..
 Frog   133 QQLQEYEMTLVKEYRLWLRQEYGRNPFNDQDKVQQLIAKQE---------------EKEQLRQVQ 182

  Fly   563 NQAKSKS 569
            ||..::|
 Frog   183 NQWINRS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 43/134 (32%)
dusp22aXP_002936144.2 PTP_DSP_cys 2..150 CDD:421693 45/146 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.