DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and styx

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001135695.1 Gene:styx / 100216269 XenbaseID:XB-GENE-967347 Length:223 Species:Xenopus tropicalis


Alignment Length:264 Identity:66/264 - (25%)
Similarity:118/264 - (44%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 IKMKLKAIMMSVDLDEVTSKYIRGRLEEIL-DMDLGEYKSFIDAEMLVILGQMDAPTKIFEHVYL 394
            :|::..::.:..:..|..:..:|..::||| .:.||.|.:.:                       
 Frog     4 VKLQFPSLPLCKEEAEDWTYPMRREMQEILPGLFLGPYSAAM----------------------- 45

  Fly   395 GSEWNASNLEELQKNGVRHILNVTREID-NF----FPGTFEYFNVRVYDDEKTNLLKYWDDTFRY 454
                 .|.|..|||.|:.|::.:.:.|: ||    |...|.|..:.:.|:...|:::::..:..:
 Frog    46 -----KSKLSVLQKCGITHVICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMSKEF 105

  Fly   455 ITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETY 519
            |......|.|||:|...|:||||::||||.|:.:..:::.|..:|::||.||.||..|::||:.|
 Frog   106 IDGCLQTGGKVLIHGNAGISRSAALVIAYIMETFGIKYRDAFTYVQERRFCINPNAGFVHQLQEY 170

  Fly   520 SGMLDA---MKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQALNQAKSKSTGEAGVTPDGEE 581
            ..:..|   :|....||..:                    ||.     .:|.:||....|.|.|:
 Frog   171 EAIYLAKLTIKMMSPLQLGR--------------------PLC-----IQSGATGSLKRTLDDED 210

  Fly   582 EDGS 585
            |.|:
 Frog   211 ELGN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 9/48 (19%)
DSPc 385..519 CDD:238073 42/138 (30%)
styxNP_001135695.1 DSP_STYX 25..175 CDD:350372 50/177 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.