DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp28

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_001344320.3 Gene:dusp28 / 100005205 ZFINID:ZDB-GENE-131127-257 Length:156 Species:Danio rerio


Alignment Length:140 Identity:49/140 - (35%)
Similarity:70/140 - (50%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 NASNLEELQKNGVRHILNVTREIDNFFPGT-FEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEG 462
            :|.|.:.:||..|...:||:::  ..||.. .....|.||||...:|.:|:|.....|......|
Zfish    18 SACNNDLIQKEAVTLCINVSKQ--QPFPSARVSTLRVPVYDDPNEDLYRYFDRCADAIASEAGRG 80

  Fly   463 SKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETYSGMLDAMK 527
            .:.:|:||.|.||||:|.:||.||........|.:.||..||.::||..|.:|||.|...|    
Zfish    81 GRTVVYCKNGRSRSATVCVAYLMKHQSLTLTDAFQVVKSARSVVEPNPGFWSQLERYEQEL---- 141

  Fly   528 NKEKLQRSKS 537
               |::||.|
Zfish   142 ---KIRRSGS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 43/120 (36%)
dusp28XP_001344320.3 DSPc 3..138 CDD:238073 43/121 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.