DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and si:ch211-223p8.8

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001139098.1 Gene:si:ch211-223p8.8 / 100004731 ZFINID:ZDB-GENE-090313-91 Length:186 Species:Danio rerio


Alignment Length:186 Identity:55/186 - (29%)
Similarity:97/186 - (52%) Gaps:17/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 EEILDMDLGEYKSFIDAEMLVILGQMDA--PTKIFEHVYLGSEWNASNLEELQKNGVRHILNVT- 418
            ::|||..|.:..:..:.|.::..||:..  ..:::.:::||..:.:.:...|...||.|:||.. 
Zfish     5 DQILDNVLHKSPTIEELEGILHGGQLSCNHVDEVWPNLFLGDMYMSHDRYGLWSLGVTHVLNAAH 69

  Fly   419 -----REIDNFFPGTFEYFNVRVYDDEKTNLLKYWDDTFRYITRA-KAEGSKVLVHCKMGVSRSA 477
                 :..|:::..|.:|:.|...|....::..::..:.:||..| ...|:||.|||.:|:||||
Zfish    70 GKMCCKGNDDYYGTTVKYYGVPANDLPTFDISPFFYPSAQYIHDALSTTGAKVFVHCAVGMSRSA 134

  Fly   478 SVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETYSGMLDAMKNKEKLQ 533
            ::|:||.|....:....|:..||:|| .|.||:.||.||.|       :.|:.|||
Zfish   135 ALVLAYLMIYCNFSLVDAILKVKERR-WIFPNRGFLKQLIT-------LDNELKLQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 5/21 (24%)
DSPc 385..519 CDD:238073 43/140 (31%)
si:ch211-223p8.8NP_001139098.1 DSPc 34..176 CDD:238073 44/149 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.