DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp3a

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_001340818.2 Gene:dusp3a / 100000665 ZFINID:ZDB-GENE-111207-3 Length:200 Species:Danio rerio


Alignment Length:140 Identity:49/140 - (35%)
Similarity:77/140 - (55%) Gaps:11/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KIFEHVYLGSEWNASNLEELQKNGVRHILNVTREID--------NFFPGT-FEYFNVRVYDDEKT 442
            ::|..:|:|:.:.|.|:..||:.||.|||||.....        .|:.|| ..|..::..|.|:.
Zfish    46 EVFPRIYIGNAFVAQNVMRLQRLGVTHILNVAEGNSFMHVNTNAEFYAGTGITYHGIQANDTEQF 110

  Fly   443 NLLKYWDDTFRYITRAKAEG-SKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCI 506
            |:..::::...:|.:|.|.| .||.|||:.|.|||.::||||.|..::.:.:.|...|:.:|. |
Zfish   111 NISAFFEEAADFIDKALAHGKGKVYVHCREGYSRSPTIVIAYLMLRHKMDVRVATATVRHKRE-I 174

  Fly   507 KPNKNFLNQL 516
            .||..||.||
Zfish   175 GPNGGFLCQL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 49/140 (35%)
dusp3aXP_001340818.2 DSPc 45..188 CDD:238073 49/140 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.