DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osbp and ORP3C

DIOPT Version :9

Sequence 1:NP_477271.1 Gene:Osbp / 42985 FlyBaseID:FBgn0020626 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_200750.1 Gene:ORP3C / 836061 AraportID:AT5G59420 Length:457 Species:Arabidopsis thaliana


Alignment Length:487 Identity:141/487 - (28%)
Similarity:222/487 - (45%) Gaps:102/487 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 DEEMEFFDAEEHGYSGSGRSPESSDCERGTFILKMHKRRSSSEDQVEGHLEGSSSESDEQKRTVQ 335
            :|...||.|...|:|..|.:.                  |.|.:.|:|: ||           |:
plant     7 NENKGFFAAMTSGFSMFGTAV------------------SRSVNGVQGN-EG-----------VE 41

  Fly   336 TVQQVCLVSAPRVASGGQGDDDDDVDKALPAKESTDSIYGRNWNPDLIKKRRDRVPDKPNHPISL 400
            .:.          ..||:.|.:::..|            || |..:    .||          |.
plant    42 VIN----------PEGGKEDAEEEAQK------------GR-WKDE----ERD----------SY 69

  Fly   401 WGIMKNCIGKDL-SKIPMPINFNEPLSMLQRLVEDYEYTEILDYAATCQDECEQLAYIAAFTVSA 464
            |.:|:..||.|: |.:.:|:...||::|||::.|..||:.:||.|..|:|...:|.|.:::.:|.
plant    70 WKMMQKYIGSDITSMVTLPVVIFEPMTMLQKMAEIMEYSHLLDQADECEDPYLRLVYASSWAISV 134

  Fly   465 YATTTNRTGKPFNPLLGETYECDRMDDYGWRCLAEQVSHHPPVAALHCESKNWTCWQEFSMTSKF 529
            | ....||.|||||:||||||  .::..|...::||||||||::|.|.|::::.    :.:|||.
plant   135 Y-YAFQRTWKPFNPILGETYE--MVNHGGISFISEQVSHHPPMSAGHAENEHFI----YDITSKL 192

  Fly   530 R----GKYVQINPLGGVYVQFPNSGRRYSWRKVTTTVNNIIVGKLWVDQHGEMEIRGSQAAEGHK 590
            :    |..|.:.|:|...|.....|.........|.::|:|.|:.|||..|||.:  :....|.|
plant   193 KTKLLGNSVDVYPVGRTRVTLKKDGVVLDLVPPLTKIHNLIFGRTWVDSPGEMVM--TNLTTGDK 255

  Fly   591 CILNFIPYSYFSRDVQRSVKGVVMNKDNEVKWVVRGTWDMKIEIAPVLKTSGSVSSPTYTTGEFK 655
            .:|.|.|..:|... :..|.|.|.:...|.|.::.|.|:.|:...|    ..:...|...| |.|
plant   256 VVLYFQPCGWFGSG-RYEVDGYVYSAAEEPKIMMTGKWNEKMSYQP----CDAEGEPLPGT-ELK 314

  Fly   656 LAWRRRPAPPDSDKFYNFTTLACQLNEEEEGVA---PTDSRLRPDQRLMEQGDWDESNKEKLRLE 717
            ..|.....|.:.:  :.:|..|.::|..:...|   .:|||:|||:..:||||..::..||..||
plant   315 EVWHLADVPKNDN--FQYTHFAHKINSFDTAPAKLLASDSRIRPDRYSLEQGDLSKAGSEKHSLE 377

  Fly   718 EKQRTERRRRENEAEEAAAEGRPYPAYEPMWF 749
            |:||.|:|.||.:.::          :.|.||
plant   378 ERQRAEKRTRETKGQK----------FTPRWF 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OsbpNP_477271.1 PH 15..107 CDD:278594
PH_OSBP_ORP4 17..113 CDD:270101
Oxysterol_BP 399..764 CDD:279564 118/359 (33%)
ORP3CNP_200750.1 Oxysterol_BP 68..418 CDD:279564 118/359 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1737
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.