DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osbp and ORP3B

DIOPT Version :9

Sequence 1:NP_477271.1 Gene:Osbp / 42985 FlyBaseID:FBgn0020626 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_187541.1 Gene:ORP3B / 820086 AraportID:AT3G09300 Length:458 Species:Arabidopsis thaliana


Alignment Length:431 Identity:142/431 - (32%)
Similarity:214/431 - (49%) Gaps:57/431 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 QGDDDDDVDKALPAKESTDSIYGRNWNPDLIKKRRDRVPDKPNHPISLWGIMKNCIGKDL-SKIP 416
            :|..||       |:|  ::..|| |      |:.||        ...|.:|:..||.|: |.:.
plant    51 EGSTDD-------AEE--EASRGR-W------KQEDR--------DGYWKMMQKYIGSDVTSMVT 91

  Fly   417 MPINFNEPLSMLQRLVEDYEYTEILDYAATCQDECEQLAYIAAFTVSAYATTTNRTGKPFNPLLG 481
            :|:...||::|||::.|..||:.:||.|...:|...::.|.:::.:|.| ....||.|||||:||
plant    92 LPVIIFEPMTMLQKMAELMEYSHLLDMADKTEDPYLRMVYASSWAISVY-YAFQRTWKPFNPILG 155

  Fly   482 ETYECDRMDDY-GWRCLAEQVSHHPPVAALHCESKNWTCWQEFSMTSKFRGKYVQINPLGGVYVQ 545
            ||||   |.:| |...::||||||||::|.|.|::::|......:.:||.|..:.:.|:|...|.
plant   156 ETYE---MANYNGVNFISEQVSHHPPMSAGHAENEHFTYDCTSKLKTKFLGNSIDVYPVGRTRVT 217

  Fly   546 FPNSGRRYSWRKVTTTVNNIIVGKLWVDQHGEMEIRGSQAAEGHKCILNFIPYSYFSRDVQRSVK 610
            ....|.........|.|:|:|.|:.|||..||| |..:|.. |.|.:|.|.|..:|... :..|.
plant   218 LKRDGVVLDLVPPLTKVHNLIFGRTWVDSPGEM-IMTNQTT-GDKVVLYFQPCGWFGSG-RYEVD 279

  Fly   611 GVVMNKDNEVKWVVRGTWDMKIEIAPVLKTSGSVSSPTYTTGEFKLAWRRRPAPPDSDKFYNFTT 675
            |.|.|...|.|.::.|.|:..:...|    ......|...| |.|..|:....|.| || |.:|.
plant   280 GYVYNASEEPKILMTGKWNESMSYQP----CDGEGEPLPGT-ELKEVWKLADVPKD-DK-YQYTH 337

  Fly   676 LACQLNEEE---EGVAPTDSRLRPDQRLMEQGDWDESNKEKLRLEEKQRTERRRRENEAEEAAAE 737
            .|.::|..:   :.:.|:|||||||:..:|.||..:|..||..:||:||.|:|.||.:.:     
plant   338 FAHKINSFDTAPKKLLPSDSRLRPDRYALEMGDMSKSGYEKSSMEERQRAEKRTREEKGQ----- 397

  Fly   738 GRPYPAYEPMWFKREKEEGSEEY----VHVFKNTYWEAKAA 774
                 |:.|.||...:|..:..:    |:.|...|.|.:||
plant   398 -----AFTPKWFDVTEEVTATPWGDLEVYQFNGKYSEHRAA 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OsbpNP_477271.1 PH 15..107 CDD:278594
PH_OSBP_ORP4 17..113 CDD:270101
Oxysterol_BP 399..764 CDD:279564 126/373 (34%)
ORP3BNP_187541.1 Oxysterol_BP 75..427 CDD:395990 127/375 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1737
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.