DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and AT5G53770

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_568798.1 Gene:AT5G53770 / 835458 AraportID:AT5G53770 Length:530 Species:Arabidopsis thaliana


Alignment Length:325 Identity:122/325 - (37%)
Similarity:180/325 - (55%) Gaps:34/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IPALCLLHQEIEQFYNYIRSTPTEFCLRAGAVRRIEDVVLSIWPSASVDLFGSFRTGLNLPDSDI 86
            ||.| .||:||..|.:::..|..|...|..||..:..|:..||||..|::|||::|||.||.|||
plant   116 IPML-QLHKEIVDFCDFLLPTQAEKAERDAAVESVSSVIKYIWPSCKVEVFGSYKTGLYLPTSDI 179

  Fly    87 DLVVYYK-FWNPRL-LHELQNELVSQGVTDPDTVTVLDKASVPVVKFTDLISRIRFDVTFNSVAS 149
            |:|:... ..||:| |..|...|..:|:.  ..:.|:.||.||::||.:..|.|.||::|: :.:
plant   180 DVVILESGLTNPQLGLRALSRALSQRGIA--KNLLVIAKARVPIIKFVEKKSNIAFDLSFD-MEN 241

  Fly   150 GVQAADLIKDFIRHFPELPKLVMVLKQFLSLHGFNEVYNSGGVSSYALTLMVISFLQQHARSNRR 214
            |.:||:.|:|.:...|.|..|.::||.||.....|||| |||:.||||..|:|:|| ::.:..|.
plant   242 GPKAAEFIQDAVSKLPPLRPLCLILKVFLQQRELNEVY-SGGIGSYALLAMLIAFL-KYLKDGRS 304

  Fly   215 LSEHSKLALLLIQFLDYYGRKFDFFKYGISVLGQG--------GCVEKARLRSTLGENNWQSVLC 271
            ..||: |.:||::|.|:||||.:....|||....|        |.:.:||          .|::.
plant   305 APEHN-LGVLLVKFFDFYGRKLNTADVGISCKMGGSFFSKYNKGFLNRAR----------PSLIS 358

  Fly   272 IEDPVTPTNDIGRSSYGVLGVMQGFGAAFVKLSKLVDSDSSKIVGP---ILANIVEVPQSIINYR 333
            ||||.||.||||:||:....:...|..|   ||.|.::.:...:||   ||..|:. |..:::.|
plant   359 IEDPQTPENDIGKSSFNYFQIRSAFAMA---LSTLTNTKAILSLGPNRSILGTIIR-PDRVLSER 419

  Fly   334  333
            plant   420  419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 45/110 (41%)
PAP_assoc 221..280 CDD:281779 23/66 (35%)
AT5G53770NP_568798.1 NT_PAP_TUTase 142..251 CDD:143392 45/111 (41%)
PAP_assoc 309..367 CDD:281779 23/68 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2959
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I1495
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016712at2759
OrthoFinder 1 1.000 - - FOG0002099
OrthoInspector 1 1.000 - - otm3460
orthoMCL 1 0.900 - - OOG6_101092
Panther 1 1.100 - - O PTHR23092
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.