DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and TENT4B

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001352253.1 Gene:TENT4B / 64282 HGNCID:30758 Length:713 Species:Homo sapiens


Alignment Length:429 Identity:161/429 - (37%)
Similarity:228/429 - (53%) Gaps:62/429 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PWQLPDVVYGNGIPALCLLHQEIEQFYNYIRSTPTEFCLRAGAVRRIEDVVLSIWPSASVDLFGS 74
            ||:..:  |..|:..   ||:||..||.|:...|.|..:|...|.|||.|:..:||||.|.:|||
Human   201 PWKRRN--YNQGVVG---LHEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGS 260

  Fly    75 FRTGLNLPDSDIDLVVYYKFWNPRLLHELQNELVSQGVTDPDTVTVLDKASVPVVKFTDLISRIR 139
            |:|||.||.|||||||:.| |....|..|:..|....|.|.|:|.|||||:||::|.||..:.::
Human   261 FKTGLYLPTSDIDLVVFGK-WENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVK 324

  Fly   140 FDVTFNSVASGVQAADLIKDFIRHFPELPKLVMVLKQFLSLHGFNEVYNSGGVSSYALTLMVISF 204
            .|::|| |.:||:||||||||.:.:|.||.||:||||||.....|||: :||:.||:|.||.:||
Human   325 VDISFN-VQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVF-TGGIGSYSLFLMAVSF 387

  Fly   205 LQQHARSNRRLSEHSKLALLLIQFLDYYGRKFDFFKYGISVLGQGGCVEKARLRSTLGENNWQSV 269
            ||.|.|.:..: .::...:|||:|.:.|||.|::.|.||.:...|..|.|..::..:.:....|:
Human   388 LQLHPREDACI-PNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSM 451

  Fly   270 LCIEDPVTPTNDIGRSSYGVLGVMQGFGAAFVKLSKLV--------DSDSSKIVGPILANIVEVP 326
            |.||||:.|.||:||||||.:.|.|.|..|:|.||..|        ::::..|:|    .|:.|.
Human   452 LYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILG----RIIRVT 512

  Fly   327 QSIINYRAWVHYNFQHLLTPELPC-----------------------------------ADSLVQ 356
            ..:..||.|:...:.....||..|                                   ::||.:
Human   513 DEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSK 577

  Fly   357 PSPTGSTSPSASASASEDERS--GGPATIGFGRCDDPPQ 393
            .|...|:.|.:|:||::...|  ...||    .|..|.|
Human   578 HSSNSSSGPVSSSSATQSSSSDVDSDAT----PCKTPKQ 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 58/108 (54%)
PAP_assoc 221..280 CDD:281779 21/58 (36%)
TENT4BNP_001352253.1 TRF4 214..>486 CDD:227585 130/275 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140748
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I3120
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016712at2759
OrthoFinder 1 1.000 - - FOG0002099
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101092
Panther 1 1.100 - - O PTHR23092
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2219
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.