DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and tent2

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001018436.1 Gene:tent2 / 553626 ZFINID:ZDB-GENE-050522-536 Length:489 Species:Danio rerio


Alignment Length:311 Identity:80/311 - (25%)
Similarity:130/311 - (41%) Gaps:77/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EFCLRAGAVRRIEDVVLSIWPSASVDLFGSFRTGLNLPDSDIDL--------------VVYYKFW 95
            |.|..|     ::..:..|:|.|.|.|.||...|.....||.||              .||....
Zfish   184 ESCRAA-----LQTDIQKIFPCAKVFLGGSSLNGFGSRSSDADLCLVIEEGPVNHRKDAVYVLSL 243

  Fly    96 NPRLLHELQNELVSQGVTDPDTVTVLDKASVPVVKFTDLISRIRFDVTFNSVASGVQAADLIKDF 160
            ..:||::|..      :..|..:    :|.||:|||.|.||.:.||:.||:.. |::...|::.:
Zfish   244 VRKLLYKLSY------IEKPQLI----RAKVPIVKFRDRISGVEFDLNFNNTV-GIRNTFLLRTY 297

  Fly   161 IRHFPELPKLVMVLKQFLSLHGFNEVYNSGGVSSYALTLMVISFLQQHARS-------------N 212
            ......:..||:|:|::.:.|..|:. :.|.:|||.|.|||:.:||.....             :
Zfish   298 AFVEKRVRPLVLVIKKWANHHCINDA-SRGTLSSYTLVLMVLHYLQTLPEPVIPCLQRDYPTCFD 361

  Fly   213 RRLSEH-----------------SKLALLLIQFLDYYGRKFDFFKYGISVLGQGGCVEKARLRST 260
            .::..|                 |.|..|.:.||.||...|.:.|..|||          |:..|
Zfish   362 PKMDIHLVPSGPSDIPAFVSRNQSSLGDLFLGFLRYYATVFKWDKQVISV----------RMART 416

  Fly   261 LGENN---WQ-SVLCIEDPVTPTNDIGRSSYGVLGVMQGFGAAFVKLSKLV 307
            |.::|   |: ..:|:|:|...|| ..|:.:..: ..:...|||::..:|:
Zfish   417 LPKSNCKEWKDKFICVEEPFNRTN-TARAVHERM-KFEAIKAAFIESHRLL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 33/122 (27%)
PAP_assoc 221..280 CDD:281779 19/62 (31%)
tent2NP_001018436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..118
NT_PAP_TUTase 182..298 CDD:143392 36/129 (28%)
PAP_assoc 386..440 CDD:281779 19/63 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.