DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and MTPAP

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_060579.3 Gene:MTPAP / 55149 HGNCID:25532 Length:582 Species:Homo sapiens


Alignment Length:361 Identity:76/361 - (21%)
Similarity:136/361 - (37%) Gaps:105/361 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IEDVVLSIWPSASVDLFGSF-----RTGLNLPDSDIDL-----VVYYKFWNPRLLHELQNELVSQ 110
            |||:..:.:|...|..|||.     :.|.:| |..:||     :..:|.....|:......:.|:
Human   214 IEDMAAAYFPDCIVRPFGSSVNTFGKLGCDL-DMFLDLDETRNLSAHKISGNFLMEFQVKNVPSE 277

  Fly   111 GVTDPDTVTVLDK-----------------ASVPVVKFTDLISRIRFDVTFNSVASGVQAADLIK 158
            .:.....::||.:                 |..|:|:|:...|..:.|:|.|: ...:.:::|:.
Human   278 RIATQKILSVLGECLDHFGPGCVGVQKILNARCPLVRFSHQASGFQCDLTTNN-RIALTSSELLY 341

  Fly   159 DFIRHFPELPKLVMVLKQFLSLHGFNEVYNSGGVSSYALTLMVISFLQQHA-------------- 209
            .:......:..||..::.:...|..........:::::||:|||.|||:.:              
Human   342 IYGALDSRVRALVFSVRCWARAHSLTSSIPGAWITNFSLTMMVIFFLQRRSPPILPTLDSLKTLA 406

  Fly   210 ----------------RSNRRL--SEHSK-LALLLIQFLDYYGRKFDFFKYGISVLGQGGCVEKA 255
                            |...|:  |:::: |.|||.:|.:|:| .|.|.|..|:: .||      
Human   407 DAEDKCVIEGNNCTFVRDLSRIKPSQNTETLELLLKEFFEYFG-NFAFDKNSINI-RQG------ 463

  Fly   256 RLRSTLGENNW--QSVLCIEDPVTPTNDIGRSSYGVLGVMQGFGAAFVKLSK-----LVDSDSSK 313
                  .|.|.  .|.|.|::|...:.:|.::      |.|.....||.|::     |...|:.:
Human   464 ------REQNKPDSSPLYIQNPFETSLNISKN------VSQSQLQKFVDLARESAWILQQEDTDR 516

  Fly   314 IVGPILANIVEVPQSIINYRAWVHYNFQHLLTPELP 349
                         .||.:.|.|   ....||.|..|
Human   517 -------------PSISSNRPW---GLVSLLLPSAP 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 27/131 (21%)
PAP_assoc 221..280 CDD:281779 19/60 (32%)
MTPAPNP_060579.3 NT_PAP_TUTase 206..344 CDD:143392 27/131 (21%)
PAP_assoc 440..483 CDD:281779 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.