DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and mkg-p

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster


Alignment Length:320 Identity:71/320 - (22%)
Similarity:124/320 - (38%) Gaps:100/320 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QEIEQFYNYIRSTPTEFCLR---AGAVRRIEDVVLSIWPSASVDLFGSFRTGLNLPDSDIDLVVY 91
            :.::..:.::|:     |:.   .|.||        ::|      |||..|||.|.:|||||.:.
  Fly    99 ENMKTCFGHVRN-----CIEKEMRGRVR--------VFP------FGSLVTGLALKESDIDLFLE 144

  Fly    92 YKFWNPRLLH-ELQNE---LVSQGVTDPDTVTVLDKASVPVVKFTDLISRIRFDVTF---NSVAS 149
            .....|.|.| :|.|:   .:.:.....|..|: ..||||:::....::.:..|:..   ||:.:
  Fly   145 PNGNQPPLFHNQLYNKTSHFLRRSKCFADVFTI-RHASVPIIRCKHQLTGLNIDINMSNPNSIYN 208

  Fly   150 GVQAADLI--KDFIRHFPELPKLVMVLKQFLSLHGFNEVYNSGGVSSYALTLMVISFLQQHARSN 212
            .....:|:  .:.||   ||...:.:..:.|.|      .:.||::||.|..::|..||    .|
  Fly   209 SRFVGELMFRNERIR---ELCLFLKIWAKKLKL------ISHGGMTSYCLISLIIVNLQ----VN 260

  Fly   213 RRLSEHSKLALLL-----------------------IQFLDYYGRKFDFF---KYGISVLGQ--G 249
            |.:....:|..|.                       :..||.....|.::   .:..|||..  |
  Fly   261 RLVPSVKELQSLCPPVILSGVNYAYSLDLTPPIPARLTTLDLLKNFFIYYCTVNFDKSVLSPFLG 325

  Fly   250 GCVEKARLRSTLG------ENNWQS------------------VLCIEDPVTPTNDIGRS 285
            |||:|   .:|||      |.:.|.                  .:|::||...:.::.:|
  Fly   326 GCVDK---ETTLGMPGGFPEYDEQQKLVHDAIGAPPDAFQLDRAMCVQDPFELSRNVAKS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 30/117 (26%)
PAP_assoc 221..280 CDD:281779 21/110 (19%)
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 32/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.