DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and Trf4-1

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001259340.1 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster


Alignment Length:376 Identity:173/376 - (46%)
Similarity:237/376 - (63%) Gaps:25/376 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KPWQLPDVVYGNGIPALCLLHQEIEQFYNYIRSTPTEFCLRAGAVRRIEDVVLSIWPSASVDLFG 73
            :||:.||..||.|:..   ||:|||.||.|:..||.|..:|...|:|||.||.||||.|.|::||
  Fly   255 EPWRKPDYPYGEGVIG---LHEEIEHFYQYVLPTPCEHAIRNEVVKRIEAVVHSIWPQAVVEIFG 316

  Fly    74 SFRTGLNLPDSDIDLVVYYKFWNPRLLHELQNELVSQGVTDPDTVTVLDKASVPVVKFTDLISRI 138
            ||||||.||.||||||| ...|....|..|:.||||:|:.:..||.||||||||::|.||..:::
  Fly   317 SFRTGLFLPTSDIDLVV-LGLWEKLPLRTLEFELVSRGIAEACTVRVLDKASVPIIKLTDRETQV 380

  Fly   139 RFDVTFNSVASGVQAADLIKDFIRHFPELPKLVMVLKQFLSLHGFNEVYNSGGVSSYALTLMVIS 203
            :.|::|| :.||||:|:|||.|.|.:|.|.|||:||||||.|...|||: :||:|||:|.||.||
  Fly   381 KVDISFN-MQSGVQSAELIKKFKRDYPVLEKLVLVLKQFLLLRDLNEVF-TGGISSYSLILMCIS 443

  Fly   204 FLQQHARSNRRLSEHSKLALLLIQFLDYYGRKFDFFKYGISVLGQGGCVEKARLRSTLGENNWQS 268
            |||.|.|.  ...:.:.|.:||::|.:.|||:|::.|.|||:...|..:.|..|:..:.:.:..|
  Fly   444 FLQMHPRG--IYHDTANLGVLLLEFFELYGRRFNYMKIGISIKNGGRYMPKDELQRDMVDGHRPS 506

  Fly   269 VLCIEDPVTPTNDIGRSSYGVLGVMQGFGAAFVKLSKLVDSDSSKIVGP----ILANIVEVPQSI 329
            :||||||:||.||||||||||..|.|.|..|:..|:..|...:...:.|    ||..|:.:...:
  Fly   507 LLCIEDPLTPGNDIGRSSYGVFQVQQAFKCAYRVLALAVSPLNLLGIDPRVNSILGRIIHITDDV 571

  Fly   330 INYRAWVHYNFQHLLTPELPCADSLVQPSPTGSTSPSASASASEDERSGGP 380
            |:||.|:..||:||:..:      .:.|.||  .:|:|.|:|     :|.|
  Fly   572 IDYREWIRENFEHLVVVD------RISPLPT--AAPTAYATA-----NGAP 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 61/108 (56%)
PAP_assoc 221..280 CDD:281779 24/58 (41%)
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 62/111 (56%)
PAP_assoc 458..518 CDD:281779 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449136
Domainoid 1 1.000 81 1.000 Domainoid score I2959
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S2207
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016712at2759
OrthoFinder 1 1.000 - - FOG0002099
OrthoInspector 1 1.000 - - otm3460
orthoMCL 1 0.900 - - OOG6_101092
Panther 1 1.100 - - P PTHR23092
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2219
SonicParanoid 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.