DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and MTPAP

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster


Alignment Length:446 Identity:86/446 - (19%)
Similarity:161/446 - (36%) Gaps:119/446 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LHQEIEQFYNYIRSTPTEFCLRAGAVRRIEDVVLSIWPSASVDLFGSFRTGLNLPDSDIDLVVYY 92
            :.::::|.|.:.|.......:|..|..:::..:..::|:|....|||...|......|:||::  
  Fly   173 IEEQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLDLIL-- 235

  Fly    93 KFWN-------------PRLLHELQNELVSQGVTDPDT------------------VTVLDKASV 126
            :|.:             .||::..:..| |.|.:....                  |..:.:|.|
  Fly   236 RFDSDMGAKIPLEAAVPSRLVYHTKENL-SNGRSQTQRHMECFGDMLHLFLPGVCHVRRILQARV 299

  Fly   127 PVVKFTDLISRIRFDVTFNSVASGVQAADLIKDFIRHFPELPKLVMVLKQFLSLHGFNEVYNSGG 191
            |::|:......:..|::.::: :|...::|:..|....|.:..|...::::....|.........
  Fly   300 PIIKYHHEHLDLEVDLSMSNL-TGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRW 363

  Fly   192 VSSYALTLMVISFLQQ-------------------------------HARSNRRLS----EHSKL 221
            :|:::||.:|:.||||                               ..|:..||.    ..|.|
  Fly   364 ISNFSLTCLVMFFLQQLRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSL 428

  Fly   222 ALLLIQFLDYYGRKFDFFKYGISVLGQGGCVEK---------------------------ARLRS 259
            :.||:||.::|. :|||....|| |.:|..:.|                           .|||.
  Fly   429 SELLLQFFEFYS-QFDFHNRAIS-LNEGKPLSKPDHSAMYIVNPLEQLLNVSKNVSLEECERLRI 491

  Fly   260 TLGENNWQSVLCIEDPVTPTNDIGRSSYGVLGVMQG-----------FGAAFVKLSKLVDSDSSK 313
            .:....|.....:|:...|..|....|.|:|.:.:.           |....|::|.|.:   .|
  Fly   492 EVRNAAWVLESEVENASVPEGDGQELSCGLLNLFKHPEKAVIRPNMFFKPRMVEVSDLFE---QK 553

  Fly   314 IVGPILANIVEVPQSIINYR-AWVHYNFQHLLTPELPCADSLVQPSPTGSTSPSAS 368
            ..|...::....|  .|.|: |.|....|.:   :......|.|...:||:.|::|
  Fly   554 EAGATSSSTPPTP--AITYKSASVRQQVQSI---KAATRSELKQLRGSGSSVPTSS 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 24/139 (17%)
PAP_assoc 221..280 CDD:281779 20/85 (24%)
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 25/143 (17%)
PAP_assoc 427..477 CDD:281779 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.