DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and Mtpap

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_038951672.1 Gene:Mtpap / 307050 RGDID:1310900 Length:584 Species:Rattus norvegicus


Alignment Length:379 Identity:80/379 - (21%)
Similarity:149/379 - (39%) Gaps:101/379 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEANPAKPWQLPDVV-YGNGIPALCLLHQEIEQFYNYIRSTPTEFCLRAGAVRRIEDVVLS---- 62
            |..:|....:|.::: |...|.|      ::.......:.|.....||......|||:..:    
  Rat   169 DSQSPPSSKKLFELLSYAESIDA------QLTALLKAFQLTEENVRLRHLTCSLIEDIAAAYFPS 227

  Fly    63 --IWP-SASVDLFGSFRTGLNLPDSDIDL-----VVYYKFWNPRLLHELQNELVSQGVTDPDTVT 119
              :|| .:||:.||  :.|.:| |..:||     :..:|.....|:......:.|:.|.....::
  Rat   228 CVVWPFGSSVNTFG--KLGCDL-DMFLDLDETGNLSDHKNTGNFLMEFQVKNVPSERVATQKILS 289

  Fly   120 VLDK-----------------ASVPVVKFTDLISRIRFDVTF-NSVASGVQAADLIKDFIRHFPE 166
            |:.:                 |..|:|:|:...|..:.|:|. ||:|  :::::|:..:......
  Rat   290 VIGECLDNFGPGCVGVQKILNARCPLVRFSHQGSGFQCDLTANNSIA--LKSSELLYIYGSLDSR 352

  Fly   167 LPKLVMVLKQFLSLHGFNEVYNSGGVSSYALTLMVISFLQQHA---------------RSNRRLS 216
            :..||..::.:...|..........:::::||:|||.|||:.:               ..:|.:.
  Rat   353 VRALVFGVRCWARAHSLTSSIPGAWITNFSLTMMVIFFLQRRSPPILPTLDSLKSMADAEDRCIL 417

  Fly   217 EHSK------------------LALLLIQFLDYYGRKFDFFKYGISVLGQGGCVEKARLRSTLGE 263
            |.:.                  |.|||.:|.:|:| .|.|.|..|:: .||            .|
  Rat   418 EGNNCTFIQDINKIKPSGNTETLELLLKEFFEYFG-NFAFNKNSINI-RQG------------RE 468

  Fly   264 NNW--QSVLCIEDPVTPTNDIGRSSYGVLGVMQGFGAAFVKLSKLVDSDSSKIV 315
            .|.  .|.|.|::|...:.:|.::      |.|.....||:|::    ||:.|:
  Rat   469 QNKPDSSPLYIQNPFETSLNISKN------VSQNQLQKFVELAR----DSAWIL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 30/138 (22%)
PAP_assoc 221..280 CDD:281779 19/60 (32%)
MtpapXP_038951672.1 RL 63..132 CDD:407669
TRF4 184..>496 CDD:227585 70/342 (20%)
NT_PAP_TUTase 209..347 CDD:143392 32/142 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.