DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and Tut4

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_036019916.1 Gene:Tut4 / 230594 MGIID:2445126 Length:1660 Species:Mus musculus


Alignment Length:312 Identity:73/312 - (23%)
Similarity:117/312 - (37%) Gaps:82/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ASVDLFGSFRTGLNLPDSDIDLVVYYKFWNPRLLHELQNELVSQGVTD---------PDTVTVL- 121
            |.:.||||.:.|....|||:|:.:..:.      ||...:|..:.:.:         |....:| 
Mouse  1008 ARLCLFGSSKNGFGFRDSDLDICMTLEG------HENAEKLNCKEIIENLAKILKRHPGLRNILP 1066

  Fly   122 -DKASVPVVKFTDLISRIRFDVT-FNSVASGVQAADLIKDFIRHFPELPKLVMVLKQFLSLHGFN 184
             ..|.||:|||....|.:..|:: :|::|.  ....::..:....|.:..|...:|.|.......
Mouse  1067 ITTAKVPIVKFEHRRSGLEGDISLYNTLAQ--HNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIG 1129

  Fly   185 EVYNSGGVSSYALTLMVISFLQQH----------------------------------------- 208
            :. :.|.:||||..|||:.||||.                                         
Mouse  1130 DA-SRGSLSSYAYILMVLYFLQQRKPPVIPVLQEQINLEDIIPNEIFDGKQIPQRMVDGWNAFFF 1193

  Fly   209 ---ARSNRRLSEHSK----LALLLIQFLDYYGRKFDFFKYGISVLGQGGCVEKARLRSTLGENNW 266
               ....:||....|    |..|.:..|.:|..:|||.:|.||       :.:.:|.:|. |..|
Mouse  1194 DKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVIS-------IRQKKLLTTF-EKQW 1250

  Fly   267 QS-VLCIEDPVTPTNDIGRSSYGVLGVMQGF-GAAFVKLSKLVDSDSSKIVG 316
            .| .:.||||....:::|.   ||...|..| ..||:...||..:....::|
Mouse  1251 TSKCIAIEDPFDLNHNLGA---GVSRKMTNFIMKAFINGRKLFGTPFYPLIG 1299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 25/105 (24%)
PAP_assoc 221..280 CDD:281779 19/59 (32%)
Tut4XP_036019916.1 rad2 <2..>366 CDD:273166
TUTase 285..621 CDD:408858
PAP_assoc 648..697 CDD:397761
TRF4 946..>1289 CDD:227585 70/300 (23%)
NT_PAP_TUTase 988..1106 CDD:143392 25/105 (24%)
AIR1 <1304..>1393 CDD:227414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.