DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and K05C4.4

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001361867.1 Gene:K05C4.4 / 187019 WormBaseID:WBGene00010581 Length:437 Species:Caenorhabditis elegans


Alignment Length:82 Identity:24/82 - (29%)
Similarity:38/82 - (46%) Gaps:8/82 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LVSQGVTDPDTVTVLDKASVPVV-KFTDLISRIRFDVTFNSVASGVQAADLIKDFIRHFPELPKL 170
            |.|:| |.||..:....||..:: ||:.::|. .|.....:.|:..:..|||......|.:|.  
 Worm    60 LHSKG-TGPDAQSAEKSASHAILDKFSVIVSS-DFRSHLINCANDNEVKDLIPQVAPFFEQLK-- 120

  Fly   171 VMVLKQFLS---LHGFN 184
            |.:...|:|   ||.|:
 Worm   121 VAIAADFMSISELHTFD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 16/54 (30%)
PAP_assoc 221..280 CDD:281779
K05C4.4NP_001361867.1 LRR_9 <336..433 CDD:373143
leucine-rich repeat 351..374 CDD:275380
leucine-rich repeat 375..398 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.