powered by:
Protein Alignment Trf4-2 and C53A5.2
DIOPT Version :9
Sequence 1: | NP_001262941.1 |
Gene: | Trf4-2 / 42983 |
FlyBaseID: | FBgn0039251 |
Length: | 407 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_506597.2 |
Gene: | C53A5.2 / 179957 |
WormBaseID: | WBGene00008263 |
Length: | 86 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 10/38 - (26%) |
Similarity: | 16/38 - (42%) |
Gaps: | 3/38 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 SVPVVKFTDLISRIRFDVTFNSVASGVQAADLIKDFIR 162
||.|..||..:..:. .:|...:|:.|...:...||
Worm 5 SVIVFFFTSFVILVS---CYNVPPTGIPAVSEVDTMIR 39
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Trf4-2 | NP_001262941.1 |
NT_PAP_TUTase |
52..161 |
CDD:143392 |
8/35 (23%) |
PAP_assoc |
221..280 |
CDD:281779 |
|
C53A5.2 | NP_506597.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5260 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.