DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and F43H9.3

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_505067.1 Gene:F43H9.3 / 179181 WormBaseID:WBGene00018399 Length:413 Species:Caenorhabditis elegans


Alignment Length:353 Identity:82/353 - (23%)
Similarity:131/353 - (37%) Gaps:102/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CLRAGAVRRIEDVVLSIWPSASVDLF--GSFRTGLNLPDSDIDLVVYYK------------FWNP 97
            |.....:..|:|:...|....:|:|.  ||..|......||.|.|.:.|            ..||
 Worm    70 CKNTKVLSFIKDLNSLILNKNAVELIPVGSMVTNFVNKQSDFDFVFFPKRDDQRHRFLRDFHQNP 134

  Fly    98 RLLHELQN------ELVSQGVTDP-DTVTVLDKASVPVVKFTDLISRIRFDVTFNSVASGVQAAD 155
            .......:      |..|..:.:| :.:..|.:..||:: ....||.:..||.|..     :...
 Worm   135 SFKQNFMSVFAKLIERESAKLGEPVEKIVELPRMRVPLI-IVRYISGLSIDVQFPE-----ENYH 193

  Fly   156 LIKDFIRHFPELPKLV--MVLKQFLSLHGF---NEVYNS--GGVSSYALTLMVISFLQQH----- 208
            .|::  .|..::.||.  .....||.|...   .||.||  |.:|||.|.|:|:.|||..     
 Worm   194 AIRN--THLMKMYKLCDHRFTLLFLWLRAICDKLEVRNSKYGLLSSYHLLLLVVHFLQSEQALSP 256

  Fly   209 -------ARSNRRL--------------------------SEHSKLAL--LLIQFLDYYGRKFDF 238
                   |:::..|                          :.|:|:|:  |:|:|:|||.. |:.
 Worm   257 WPVLPVLAKTHPNLVTSEIPISKVAELIKSENPCLSDFSWTSHNKMAISELIIRFVDYYNH-FNA 320

  Fly   239 FKYGISVLGQGGCVEKA---RLRSTLGENNWQSVLCIEDPVTPTNDIGRSSYGVLGVMQGFGAAF 300
            .|..|       .:||.   :.:...||...|.:    ||.:|.: :.||.:    ....|.||.
 Worm   321 AKEAI-------YIEKGLALKRKQVFGEVRLQLI----DPYSPVS-VCRSHH----ASSAFFAAI 369

  Fly   301 VKLSKLVDSDSSKIVGPILANIVEVPQS 328
            ..:.|...:      |.:||::.|||::
 Worm   370 QFMRKQFKN------GQMLASLPEVPEA 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 27/129 (21%)
PAP_assoc 221..280 CDD:281779 18/63 (29%)
F43H9.3NP_505067.1 NT_Pol-beta-like 79..204 CDD:386233 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.