DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and cid-1

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_498099.1 Gene:cid-1 / 175707 WormBaseID:WBGene00019629 Length:1425 Species:Caenorhabditis elegans


Alignment Length:358 Identity:87/358 - (24%)
Similarity:141/358 - (39%) Gaps:118/358 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EANPAKPWQ------------LPDVVYGNGI---PALCLLHQEIEQFYNYIRSTPTEFCLRAGAV 53
            |..|.|.:|            :.|..|...|   ..|.:|..:|::..:::|....         
 Worm   991 EIPPIKKYQARTPEDLKDIDDMIDKYYHENILDERRLKMLDHKIDELQSFLRKNYR--------- 1046

  Fly    54 RRIEDVVLSIWPSASVDLFGSFRTGLNLPDSDIDLVVYYKFWN----PRLLHELQNELVSQGVTD 114
               |||.|:        .|||..|||::..||||:.:  :|.:    |:       :|.::.|..
 Worm  1047 ---EDVTLT--------TFGSVMTGLSVNCSDIDICL--RFGDGDVPPK-------DLTAKEVIQ 1091

  Fly   115 PDTVTVLDK------------ASVPVVKFTDLISR---IRFDVTFNSVASGVQAADLIKDFIRHF 164
             .|.:||.|            |.||:|||...:|.   |..|:::.::.:....| |:|::....
 Worm  1092 -KTESVLRKCHLVKRVQAIVTAKVPIVKFQVKLSNGAIIDVDISYYNILAIYNTA-LLKEYSLWT 1154

  Fly   165 PE--LPKLVMVLKQFLSLHGFNEVYNSGGVSSYALTLMVISF-----------LQQHARSN---R 213
            |:  ..||.:.:|.:.......:. :.|.:|||...:|:||:           ||:..||:   |
 Worm  1155 PDKRFAKLALFVKTWAKNCEIGDA-SRGSLSSYCHVIMLISYLQNCDPPVLPRLQEDFRSDNRER 1218

  Fly   214 RLSEH--------------------SKLALLLIQFLDYYGRKFDFFKYGISVLGQGGCVEKARLR 258
            ||.::                    ...|.|||.:.|||.| |||..:          |.:.|..
 Worm  1219 RLVDNWDTSFAQVETSLLQRWPKNKESCAQLLIGYFDYYSR-FDFRNF----------VVQCRRE 1272

  Fly   259 STLG--ENNWQSVLCIEDPVTPTNDIGRSSYGV 289
            ..|.  |..|...||:|||...::::   |.||
 Worm  1273 MILSKMEKEWPRPLCVEDPFDLSHNL---SSGV 1302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 34/127 (27%)
PAP_assoc 221..280 CDD:281779 21/60 (35%)
cid-1NP_498099.1 PAP_assoc 574..625 CDD:367682
NT_PAP_TUTase 1029..1151 CDD:143392 37/152 (24%)
TRF4 1034..>1317 CDD:227585 78/315 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.