DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and tut4

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_002931502.3 Gene:tut4 / 100141500 XenbaseID:XB-GENE-1217309 Length:1562 Species:Xenopus tropicalis


Alignment Length:297 Identity:70/297 - (23%)
Similarity:114/297 - (38%) Gaps:71/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LFGSFRTGLNLPDSDIDLVVYYKFWNPRLLHELQNELVSQGVTDP-----------DTVTVLDKA 124
            ||||.:.|....|||:|:.:..:.      ||...:|..:.:.|.           ..:..:..|
 Frog   908 LFGSSKNGFGFRDSDLDICMTLEG------HENAKKLNCKEIIDGLAKVLKKHPGLKNILAITTA 966

  Fly   125 SVPVVKFTDLISRIRFDVT-FNSVASGVQAADLIKDFIRHFPELPKLVMVLKQFLSLHGFNEVYN 188
            .||:|||....|.:..|:: :|::|.  ....::..:....|.:..|...:|.|.......:. :
 Frog   967 KVPIVKFEHKESGVEGDISLYNTLAQ--HNTRMLATYAAIDPRVKYLGYTVKFFAKRCDIGDA-S 1028

  Fly   189 SGGVSSYALTLMVISFLQQH--------------ARSNRRL-----------------------S 216
            .|.:||||..|||:.||||.              ..:.:|:                       .
 Frog  1029 RGSLSSYAYILMVLYFLQQRNPPVIPVLQEIYDGQETPQRMVDGWNAFFFDNTEELRNRFPSLGK 1093

  Fly   217 EHSKLALLLIQFLDYYGRKFDFFKYGISVLGQGGCVEKARLRSTLGENNWQS-VLCIEDPVTPTN 280
            ....:..|.:.||.:|..:|||.:|.||       :.:.:|.:|. |..|.| .:.||||....:
 Frog  1094 NRESVGELWLGFLRFYTEEFDFKEYVIS-------IRQKKLLTTF-EKQWTSKCIAIEDPFDLNH 1150

  Fly   281 DIGRSSYGVLGVMQGF-GAAFVKLSKLVDSDSSKIVG 316
            ::|.   ||...|..| ..||:...||..:....|.|
 Frog  1151 NLGA---GVSRKMTNFIMKAFINGRKLFGTPIYPIPG 1184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 23/101 (23%)
PAP_assoc 221..280 CDD:281779 19/59 (32%)
tut4XP_002931502.3 TUTase 200..532 CDD:408858
PAP_assoc 561..610 CDD:397761
TRF4 842..>1174 CDD:227585 66/285 (23%)
PTZ00368 <1201..>1277 CDD:173561
PHA03247 <1290..1551 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.