DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-2 and tut1

DIOPT Version :9

Sequence 1:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_002941502.3 Gene:tut1 / 100127188 XenbaseID:XB-GENE-491663 Length:843 Species:Xenopus tropicalis


Alignment Length:307 Identity:57/307 - (18%)
Similarity:97/307 - (31%) Gaps:109/307 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LHQEIEQFYNYIRSTPTEFCLRAGAVRRIEDVVLSIWPSASVDLFGSFRTGLNLPDSDIDLVVYY 92
            :.|:|::..:....:..|..||...:..:::.....:|...:..|||...|..:...|:||  |.
 Frog   169 VEQQIKKLVSLCSPSHHESHLRELLLSLLQETFTEFFPGCQLLPFGSSVNGFEISGCDLDL--YL 231

  Fly    93 KFWNP-------RLLHELQNELVSQ-----GVTDPDT---------------------------- 117
            ...:.       :...|:||...|.     .:.||:|                            
 Frog   232 DLGDDEAENVEGKAEKEIQNREESSTDMEVSIEDPETERKEEEMEIGNSKNDEDEDVTPGLSLKG 296

  Fly   118 -----------------------VTVLDKASVPVVKFTDLISRIRFDVTFNSVASGVQAADLIKD 159
                                   |..:..|..||:.|....|.:|.|||.|:     :.|.....
 Frog   297 LSSEEILEVVGKVLRHCVPGVHGVQSVPTARRPVIHFQHKTSGLRGDVTLNN-----RLALRNSS 356

  Fly   160 FIRHFPEL----PKLVMVLKQFLSLHGFNEVYNSGG--VSSYALTLMVISFLQQ----------H 208
            |:|...:|    |:||..::.:..::........||  :::|||||:|..|||.          |
 Frog   357 FLRLCSDLDARVPQLVYTVRYWARVNQLAGNPFGGGPLLNNYALTLLVFFFLQTRNPPVLPTLVH 421

  Fly   209 ARSN-----------------------RRLSEHSKLALLLIQFLDYY 232
            .|..                       :.......|:.||.:|..:|
 Frog   422 LREETANEVPQVIDGWDCSFPSDPAQVKESGNQQSLSSLLSEFFSFY 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 28/171 (16%)
PAP_assoc 221..280 CDD:281779 5/12 (42%)
tut1XP_002941502.3 RRM_TUT1 63..136 CDD:409721
NT_PAP_TUTase 198..362 CDD:143392 30/170 (18%)
TRF4 <320..>512 CDD:227585 36/154 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.