Sequence 1: | NP_001262941.1 | Gene: | Trf4-2 / 42983 | FlyBaseID: | FBgn0039251 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002941502.3 | Gene: | tut1 / 100127188 | XenbaseID: | XB-GENE-491663 | Length: | 843 | Species: | Xenopus tropicalis |
Alignment Length: | 307 | Identity: | 57/307 - (18%) |
---|---|---|---|
Similarity: | 97/307 - (31%) | Gaps: | 109/307 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 LHQEIEQFYNYIRSTPTEFCLRAGAVRRIEDVVLSIWPSASVDLFGSFRTGLNLPDSDIDLVVYY 92
Fly 93 KFWNP-------RLLHELQNELVSQ-----GVTDPDT---------------------------- 117
Fly 118 -----------------------VTVLDKASVPVVKFTDLISRIRFDVTFNSVASGVQAADLIKD 159
Fly 160 FIRHFPEL----PKLVMVLKQFLSLHGFNEVYNSGG--VSSYALTLMVISFLQQ----------H 208
Fly 209 ARSN-----------------------RRLSEHSKLALLLIQFLDYY 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Trf4-2 | NP_001262941.1 | NT_PAP_TUTase | 52..161 | CDD:143392 | 28/171 (16%) |
PAP_assoc | 221..280 | CDD:281779 | 5/12 (42%) | ||
tut1 | XP_002941502.3 | RRM_TUT1 | 63..136 | CDD:409721 | |
NT_PAP_TUTase | 198..362 | CDD:143392 | 30/170 (18%) | ||
TRF4 | <320..>512 | CDD:227585 | 36/154 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |