DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11168 and anks1b

DIOPT Version :9

Sequence 1:NP_001262939.1 Gene:CG11168 / 42981 FlyBaseID:FBgn0039249 Length:863 Species:Drosophila melanogaster
Sequence 2:XP_031754554.1 Gene:anks1b / 108646221 XenbaseID:XB-GENE-947075 Length:294 Species:Xenopus tropicalis


Alignment Length:219 Identity:77/219 - (35%)
Similarity:103/219 - (47%) Gaps:60/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   668 SLHIRDPAELLLGRKPSAASSNWCHSPYTFIYGEIRYSLF------------------------- 707
            |:.:|.|.|    ...|.....|.|.|...|:....|..:                         
 Frog    43 SISLRAPNE----TTGSIPFQYWQHHPEKLIFQACDYKAYSMPFGGKYRPIVNPVPHPQCSWSVM 103

  Fly   708 --YLGSTVIRKLQGTLSTRKSIQKLKIDENLKSAASVSDFSLLENCTTSTKYLKAANHQTRLNVD 770
              ||||.:|::|:||.||:.:..|::                     .||:.:|...     .:.
 Frog   104 TKYLGSMLIKELRGTESTQDACSKMR---------------------KSTEQMKKVP-----TII 142

  Fly   771 IAVSCVGVKFIDHDKKTAICCHDIENINCVCQDSEDLRYFAYITKE--QDLHYCHVFMVDSLELA 833
            :.||..||||:|...|:.|..|:|.||:|..||.|||..||||||:  .:|||||||....:.||
 Frog   143 LTVSYKGVKFVDAVNKSMIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNLHYCHVFTAFDVNLA 207

  Fly   834 KEIIMTLGQAFEVAYQLAL-SRQG 856
            .|||:|||||||||||||| :|:|
 Frog   208 YEIILTLGQAFEVAYQLALQARKG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11168NP_001262939.1 Ank_4 6..69 CDD:290365
ANK repeat 7..46 CDD:293786
ANK 43..171 CDD:238125
ANK repeat 48..79 CDD:293786
Ank_2 53..148 CDD:289560
ANK repeat 81..115 CDD:293786
ANK 112..254 CDD:238125
ANK repeat 117..148 CDD:293786
Ank_2 122..230 CDD:289560
ANK repeat 204..232 CDD:293786
Ank_5 221..273 CDD:290568
ANK repeat 234..264 CDD:293786
PTB_Anks 688..857 CDD:269972 72/199 (36%)
anks1bXP_031754554.1 PTB_Anks 59..231 CDD:269972 71/197 (36%)
PRK10938 <214..>280 CDD:182852 15/18 (83%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003340
OrthoInspector 1 1.000 - - mtm9472
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.