DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10845 and SMY1

DIOPT Version :9

Sequence 1:NP_651309.2 Gene:CG10845 / 42978 FlyBaseID:FBgn0039246 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_012844.1 Gene:SMY1 / 853783 SGDID:S000001562 Length:656 Species:Saccharomyces cerevisiae


Alignment Length:460 Identity:99/460 - (21%)
Similarity:171/460 - (37%) Gaps:121/460 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QLEVSAEAISEVLDQVLGGRISTVFSCGRIPFNHGADPSDVVSR----ILNELFTRIYE-LETNM 90
            |.:|....:..:::.||.|...||.:.|  |...|...|.:.|:    ||..:...::: ||.|.
Yeast    87 QEDVQKFLVHPIINDVLNGYNGTVITYG--PSFSGKSYSLIGSKESEGILPNICKTLFDTLEKNE 149

  Fly    91 EV-----HVSVRYVQLNGE-TNDLVVNLKGCNRRTTRDH----------------FVATSHGVHA 133
            |.     .|||...::..| |.||:|.|.  .|:..:.|                .|.:...:.:
Yeast   150 ETKGDSFSVSVLAFEIYMEKTYDLLVPLP--ERKPLKLHRSSSKMDLEIKDICPAHVGSYEDLRS 212

  Fly   134 YIARVM---DKVAEGGDC----PHLIFTVHVKQTN--GDQLRKCCGRLQLVHLQQLTEDSPPLES 189
            ||..|.   :::|.|...    .||:|.:||:|.|  .|.|:.  ..|.||.|....:.....||
Yeast   213 YIQAVQNVGNRMACGDKTERSRSHLVFQLHVEQRNRKDDILKN--SSLYLVDLHGAEKFDKRTES 275

  Fly   190 DTPLDTLISLFQVLANSPKTHIR--------------------YYNIRLTRLLNQLMGNGSRTVI 234
            ....|.|..|.|.: .:.|..:|                    |...:||.:|...:|...:|.:
Yeast   276 TLSQDALKKLNQSI-EALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKV 339

  Fly   235 I---------------NYADPPEGKDDPVTPAPT-----------------PSSNSNASLPDEVW 267
            |               .:.|.....::.||...|                 ...|..|.:     
Yeast   340 ILTCFLSNVPTTLSTLEFGDSIRQINNKVTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQI----- 399

  Fly   268 RRLLRQERAKYRCLRNKALGIVVDKEELERF----------LESLE--ASDSSEEDISDGDFEQK 320
             .:|:.|....:.|.||:|....:|:.||..          |:|:.  .|.|:.|| .:...:::
Yeast   400 -NILKAEIDSLKSLHNKSLPEDDEKKMLENTKKENIKLKLQLDSITQLLSSSTNED-PNNRIDEE 462

  Fly   321 VEQKMLAIRSEAEMSIKKLKGLQMDIDYLTERNCHLEQQLDQKNSQLNMQSNLMLSIHMELRDQT 385
            |.: :|..|.|      ::..|::..|.....|..|:|:|:.|.|:.....::.:.:..:::.|.
Yeast   463 VSE-ILTKRCE------QIAQLELSFDRQMNSNSKLQQELEYKKSKEEALESMNVRLLEQIQLQE 520

  Fly   386 RKFQD 390
            |:.|:
Yeast   521 REIQE 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10845NP_651309.2 Motor_domain 16..236 CDD:277568 63/275 (23%)
SMY1NP_012844.1 KISc_KHC_KIF5 25..364 CDD:276820 64/283 (23%)
Smc <254..568 CDD:224117 55/289 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.