DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10845 and kif5ab

DIOPT Version :9

Sequence 1:NP_651309.2 Gene:CG10845 / 42978 FlyBaseID:FBgn0039246 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_009301044.1 Gene:kif5ab / 799274 ZFINID:ZDB-GENE-110510-3 Length:1050 Species:Danio rerio


Alignment Length:550 Identity:124/550 - (22%)
Similarity:204/550 - (37%) Gaps:169/550 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RVYLFRKLLTSPTD-LQLEVSAEAISEVLDQVLGGRISTVFSCGRIPFN---------HGADPSD 70
            |.|:|.|:.  ||: .|.:|......:::..||.|...|:|:.|:....         |.|:...
Zfish    45 RSYVFDKVF--PTNCTQEQVYNTCAQQIVKDVLDGYNGTIFAYGQTSSGKTYTMEGKLHDANGRG 107

  Fly    71 VVSRILNELFTRIYELETNMEVHVSVRYVQLN-----------------GETNDLVVNLKGCNRR 118
            ::.||..::|..||.::.|:|.|:.|.|.::.                 .|..:.|..:|||..|
Zfish   108 IIPRIAEDIFNHIYTMDENLEFHIKVSYFEIYMDKIRDLLDVTKTNLSVHEDKNRVPYVKGCTER 172

  Fly   119 TTRDHFVATSHGVHAYIARVMDKVAEG--------------GDCPHLIFTVHVKQTNGDQLRKCC 169
                 ||::..       .|||.:.||              ....|.||.:::||.:.:..:|.|
Zfish   173 -----FVSSPE-------EVMDLIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQEHVETEQKLC 225

  Fly   170 GRLQLVHLQQLTEDSPPLESDTPLD----------TLISLFQVLANSPKTHIRYYNIRLTRLLNQ 224
            |:|.||.|....:.|........||          .|.::...||...|||:.|.:.::||:|..
Zfish   226 GKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQD 290

  Fly   225 LMGNGSRTVIINYADPPEGKDDPVTPAPTPSS-----------NS---NASLPDEVWRRLLRQER 275
            .:|...||.:.....|....|     |.|.|:           ||   |..|..|.|:|...:|:
Zfish   291 SLGGNCRTTMFICCSPSAYND-----AETKSTLMFGQRAKTIMNSASVNLELTAEQWKRKYEKEK 350

  Fly   276 AKYRCLRNKALGIVVDKEELERFLESLE---------------------ASDSSEEDISDGDFEQ 319
            .|     ||.|     ||.::|....|.                     ..|::.::.|.|..|.
Zfish   351 EK-----NKDL-----KESMQRLEAELNHWRNGESVVLITPVSPAECDVTEDTAVDNQSHGQTEL 405

  Fly   320 KVEQKMLAIRSEAEMSIKKLKGLQMDIDYLTERNCHLEQQLDQKNSQLNMQSNLMLSIHMELRDQ 384
            ..||.    .|..|..|::                 |.:|||.|:.::|:|..|:..:..::.||
Zfish   406 IPEQH----NSRYEEEIQQ-----------------LYRQLDDKDDEINLQCQLVEKLKEQMLDQ 449

  Fly   385 -----------------TRKFQD-------KIAEYTDKFQEM---WERQRLDIQYNEQRQLRQLT 422
                             .|:.|.       ::.|.....:|:   ::.:.|:.|.| .|..|:||
Zfish   450 EELLACARADLERVQCDVRRLQADSESSKLEVQEVLQALEELALSYDHKSLEAQDN-SRHNRRLT 513

  Fly   423 KLFDSLCQATQRWLHRKT--SRLPQKDADE 450
               :.|...|...|..::  |||.:.:..:
Zfish   514 ---EELAHTTSALLSLESDFSRLQEVNGQQ 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10845NP_651309.2 Motor_domain 16..236 CDD:277568 67/270 (25%)
kif5abXP_009301044.1 KISc_KHC_KIF5 7..327 CDD:276820 72/300 (24%)
KISc 9..334 CDD:214526 74/307 (24%)
DUF2570 847..964 CDD:305162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.