DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10845 and LZTFL1

DIOPT Version :9

Sequence 1:NP_651309.2 Gene:CG10845 / 42978 FlyBaseID:FBgn0039246 Length:463 Species:Drosophila melanogaster
Sequence 2:XP_016862134.1 Gene:LZTFL1 / 54585 HGNCID:6741 Length:308 Species:Homo sapiens


Alignment Length:338 Identity:68/338 - (20%)
Similarity:130/338 - (38%) Gaps:81/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 VNLKGCNRRTTRDHFVATSHGVHAYI------ARVMDKVAEGGDCPHLIFTVHVKQTNGDQLRKC 168
            :|.||..|::.:      .:..|..:      |:..:|.....|    .||:       |::.:.
Human    19 INRKGRQRKSIK------LYPTHPLVTFPRSWAKFQEKALLVED----TFTI-------DEVSEV 66

  Fly   169 CGRLQ-LVHLQQLTEDSPPLESD---TPLDTLISLFQVLANSPKTHIRYY----NIRLTRLLNQL 225
            ...|| :||.:        :||:   |....::.|.|:.|.:.|.:::..    .:....||.|:
Human    67 LNGLQAVVHSE--------VESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQV 123

  Fly   226 -------MGNGSRTVIINYADPPEGKDDPVTPAPTPSSNSNASLPDEVWRRLLRQERAKYR--CL 281
                   :.:.::..|::...|        ..||.....:...|..|:.|.....|:.|.|  .:
Human   124 AEFEKAEITSSNKKPILDVTKP--------KLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTI 180

  Fly   282 RNKALGIVVDKEELERFLESLEASDSSEEDISDGDFEQKVEQKMLAIRSEAEMSIKKLKGLQMDI 346
            ..:|...:.:|.:||:.|:.|:....:::|.........:|..:.|::||          .|..:
Human   181 EIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSNLENTVAALKSE----------FQKTL 235

  Fly   347 DYLTERNCHLEQQL-DQKNSQLNMQSNLMLSIHMELRDQTRKFQDKIAEYTDKFQEMWERQRLDI 410
            :..||....||:.| ..|:..|.:|..|    ||..::..:||| :.|.|         |...:|
Human   236 NDKTENQKSLEENLATAKHDLLRVQEQL----HMAEKELEKKFQ-QTAAY---------RNMKEI 286

  Fly   411 QYNEQRQLRQLTK 423
            ...:..|::.|.|
Human   287 LTKKNDQIKDLRK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10845NP_651309.2 Motor_domain 16..236 CDD:277568 26/146 (18%)
LZTFL1XP_016862134.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.