DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10845 and ZC262.7

DIOPT Version :9

Sequence 1:NP_651309.2 Gene:CG10845 / 42978 FlyBaseID:FBgn0039246 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001293636.1 Gene:ZC262.7 / 24105263 WormBaseID:WBGene00043948 Length:171 Species:Caenorhabditis elegans


Alignment Length:105 Identity:21/105 - (20%)
Similarity:49/105 - (46%) Gaps:20/105 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 SEAEMSI------KKLKGLQMDIDYLTE-------RNCHLEQQLDQKNSQLNMQSNLMLSIHMEL 381
            :|.|.|:      ::::.|:.::|.||:       .|..|..:|.:..::|..:.:.:..:...|
 Worm    14 TEGEDSLSGPAQKQRIQFLENNLDKLTKVHKQLVRDNADLRVELPKMEARLRGREDRIKILETAL 78

  Fly   382 RDQTRKFQDKIAEYTDKFQEMWERQRLDIQYNEQRQLRQL 421
            ||..::.|.:..:|..:.:.:.|..|       ||.:|::
 Worm    79 RDSKQRSQAERKKYQQEVERIKEAVR-------QRNMRRM 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10845NP_651309.2 Motor_domain 16..236 CDD:277568
ZC262.7NP_001293636.1 Striatin <26..96 CDD:285445 13/69 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.