DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10845 and ZC262.7

DIOPT Version :10

Sequence 1:NP_651309.2 Gene:CG10845 / 42978 FlyBaseID:FBgn0039246 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001293636.1 Gene:ZC262.7 / 24105263 WormBaseID:WBGene00043948 Length:171 Species:Caenorhabditis elegans


Alignment Length:105 Identity:21/105 - (20%)
Similarity:49/105 - (46%) Gaps:20/105 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 SEAEMSI------KKLKGLQMDIDYLTE-------RNCHLEQQLDQKNSQLNMQSNLMLSIHMEL 381
            :|.|.|:      ::::.|:.::|.||:       .|..|..:|.:..::|..:.:.:..:...|
 Worm    14 TEGEDSLSGPAQKQRIQFLENNLDKLTKVHKQLVRDNADLRVELPKMEARLRGREDRIKILETAL 78

  Fly   382 RDQTRKFQDKIAEYTDKFQEMWERQRLDIQYNEQRQLRQL 421
            ||..::.|.:..:|..:.:.:.|..|       ||.:|::
 Worm    79 RDSKQRSQAERKKYQQEVERIKEAVR-------QRNMRRM 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10845NP_651309.2 Motor_domain 16..236 CDD:473979
PLN03229 <283..372 CDD:178768 11/54 (20%)
ZC262.7NP_001293636.1 Khc_CBD_cc 31..100 CDD:467880 13/68 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.