DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11069 and ARB1

DIOPT Version :9

Sequence 1:NP_651307.2 Gene:CG11069 / 42976 FlyBaseID:FBgn0039244 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_010953.1 Gene:ARB1 / 856758 SGDID:S000000838 Length:610 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:47/213 - (22%)
Similarity:77/213 - (36%) Gaps:80/213 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VNLTVHSGEVMAILGSKGSGKRALLDVISRRADGATRGQVLLNGSPLSKALFQQRCGYVTQSCTF 104
            :|..|.....:|::|..|.||..||.:::        |::    :|.|        |.|::    
Yeast   414 LNFGVDMDSRIALVGPNGVGKSTLLKIMT--------GEL----TPQS--------GRVSR---- 454

  Fly   105 VPGLTVAQTLHYTPTILSGYLKSSKVRQVLADLALSQVAHKRVEYLNIS---------------- 153
                       :|...|..|.:.|   |...||..|.:...|.:|.|||                
Yeast   455 -----------HTHVKLGVYSQHS---QDQLDLTKSALEFVRDKYSNISQDFQFWRGQLGRYGLT 505

  Fly   154 --------------EARRLAIGIQLVRDPVMLLLDEPTHGLD-PLSAYLLISILSNTAKKTGCGI 203
                          :..|:...:..:..|.:|||||||:||| |     .|..|::...:...|:
Yeast   506 GEGQTVQMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIP-----TIDSLADAINEFNGGV 565

  Fly   204 LL------SLEKPRSDVF 215
            ::      .|:|...|:|
Yeast   566 VVVSHDFRLLDKIAQDIF 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11069NP_651307.2 ABCG_White 15..233 CDD:213201 47/213 (22%)
CcmA 31..302 CDD:224054 47/213 (22%)
ABC2_membrane 364..515 CDD:304374
ARB1NP_010953.1 Uup 79..601 CDD:223562 47/213 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.