Sequence 1: | NP_651307.2 | Gene: | CG11069 / 42976 | FlyBaseID: | FBgn0039244 | Length: | 604 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010953.1 | Gene: | ARB1 / 856758 | SGDID: | S000000838 | Length: | 610 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 213 | Identity: | 47/213 - (22%) |
---|---|---|---|
Similarity: | 77/213 - (36%) | Gaps: | 80/213 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 VNLTVHSGEVMAILGSKGSGKRALLDVISRRADGATRGQVLLNGSPLSKALFQQRCGYVTQSCTF 104
Fly 105 VPGLTVAQTLHYTPTILSGYLKSSKVRQVLADLALSQVAHKRVEYLNIS---------------- 153
Fly 154 --------------EARRLAIGIQLVRDPVMLLLDEPTHGLD-PLSAYLLISILSNTAKKTGCGI 203
Fly 204 LL------SLEKPRSDVF 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11069 | NP_651307.2 | ABCG_White | 15..233 | CDD:213201 | 47/213 (22%) |
CcmA | 31..302 | CDD:224054 | 47/213 (22%) | ||
ABC2_membrane | 364..515 | CDD:304374 | |||
ARB1 | NP_010953.1 | Uup | 79..601 | CDD:223562 | 47/213 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |