DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11069 and ABCG25

DIOPT Version :9

Sequence 1:NP_651307.2 Gene:CG11069 / 42976 FlyBaseID:FBgn0039244 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_565030.1 Gene:ABCG25 / 843527 AraportID:AT1G71960 Length:662 Species:Arabidopsis thaliana


Alignment Length:573 Identity:135/573 - (23%)
Similarity:239/573 - (41%) Gaps:115/573 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VLKGVNLTVHSGEVMAILGSKGSGKRALLDVISRRADGAT-RGQVLLNGSPLSKALFQQRCGYVT 99
            :|.||...:..||.||:||..||||..||:.::.|..|:. .|::|:|...::|... :|.|:|.
plant    83 ILSGVTGMISPGEFMAVLGPSGSGKSTLLNAVAGRLHGSNLTGKILINDGKITKQTL-KRTGFVA 146

  Fly   100 QSCTFVPGLTVAQTLHYT-----PTILSGYLKSSKVRQVLADLALSQ-----VAHKRVEYLNISE 154
            |.....|.|||.:||.:.     |..|:..:|......|:::|.|::     |.:..:..::..|
plant   147 QDDLLYPHLTVRETLVFVALLRLPRSLTRDVKLRAAESVISELGLTKCENTVVGNTFIRGISGGE 211

  Fly   155 ARRLAIGIQLVRDPVMLLLDEPTHGLDPLSAYLLISILSNTAKKTGCGILLSLEKPRSDVFPFLD 219
            .:|::|..:|:.:|.:|:|||||.|||..:|..|:..|:..|...|..::.|:.:|.|.||...|
plant   212 RKRVSIAHELLINPSLLVLDEPTSGLDATAALRLVQTLAGLAHGKGKTVVTSIHQPSSRVFQMFD 276

  Fly   220 RALFLCLGGVVYSGGTRAMLEYFHGIGFPCPQLENPLMYYLCLST-------VDRRSRDRFLES- 276
            ..|.|..|..::.|..|..:.||..:||......||..:.|.|:.       |..|.:....:: 
plant   277 TVLLLSEGKCLFVGKGRDAMAYFESVGFSPAFPMNPADFLLDLANGVCQTDGVTEREKPNVRQTL 341

  Fly   277 --------SQQIEALVERFSRETPISDAPLNN-------MGSGKVPLAYGKPGELKVW-----VM 321
                    :.|::..:|       :|..|.:|       :..|.:...      :..|     ::
plant   342 VTAYDTLLAPQVKTCIE-------VSHFPQDNARFVKTRVNGGGITTC------IATWFSQLCIL 393

  Fly   322 LY----------------LKLLASTFSCGLVGMKTLFLRLLLLPLALSILW--AFYTDVGDDSHG 368
            |:                .:::|::..|||                   :|  :.|.||.|    
plant   394 LHRLLKERRHESFDLLRIFQVVAASILCGL-------------------MWWHSDYRDVHD---- 435

  Fly   369 FFTKNGMILNILGLSYGCGIL---TTISLFPIWRKKFSQDTPEGLYSGTTLLIAYNSVSIPFSAV 430
               :.|::..|   |...|:|   ..:..||..|..|:::...|:|:.::..:|:...|:....|
plant   436 ---RLGLLFFI---SIFWGVLPSFNAVFTFPQERAIFTRERASGMYTLSSYFMAHVLGSLSMELV 494

  Fly   431 SAVIASCVVYPLLLDVKYNNGTVFAYLLVALWSSFVLAEQ-LTIAFLLVVKVPFNAAIAVTYVLV 494
              :.||.:.:...: |....|.|...|.:::...:|||.| |.:|....:.....|:..||..::
plant   495 --LPASFLTFTYWM-VYLRPGIVPFLLTLSVLLLYVLASQGLGLALGAAIMDAKKASTIVTVTML 556

  Fly   495 ISIALASGTVRSFKGLQPWLQDNTKGTHTRYASSLLHSIAFQS-----RKLNC 542
            ..:......|........|::   ..:.|.|...||.:|.:.|     |.|.|
plant   557 AFVLTGGYYVNKVPSGMVWMK---YVSTTFYCYRLLVAIQYGSGEEILRMLGC 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11069NP_651307.2 ABCG_White 15..233 CDD:213201 66/207 (32%)
CcmA 31..302 CDD:224054 83/299 (28%)
ABC2_membrane 364..515 CDD:304374 32/154 (21%)
ABCG25NP_565030.1 PLN03211 1..662 CDD:215634 135/573 (24%)
ABCG_EPDR 70..290 CDD:213180 66/207 (32%)
ABC2_membrane 393..592 CDD:279410 45/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1022017at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.