DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11069 and ABCG8

DIOPT Version :9

Sequence 1:NP_651307.2 Gene:CG11069 / 42976 FlyBaseID:FBgn0039244 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_200098.1 Gene:ABCG8 / 835363 AraportID:AT5G52860 Length:589 Species:Arabidopsis thaliana


Alignment Length:516 Identity:135/516 - (26%)
Similarity:237/516 - (45%) Gaps:91/516 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ALVLKGVNLTVHSGEVMAILGSKGSGKRALLDVISRRADGATRGQVLLNGSPLSKALFQQRCGYV 98
            :.:|:.:.||.|..|::|::|..|:||..|||:::.:. ..|.|.:|||..|::.:.:::...||
plant    42 SFILRNITLTAHPTEILAVVGPSGAGKSTLLDILASKT-SPTSGSILLNSIPINPSSYRKISSYV 105

  Fly    99 TQSCTFVPGLTVAQTLHYTPTIL--SGYLKSSKVRQVLADLALSQVAHKRV-EYLNISEARRLAI 160
            .|..:|.|.|||::|..:...:|  :..:.|..|..:|::|.|:.::|.|: :.|:..|.||::|
plant   106 PQHDSFFPLLTVSETFSFAACLLLPNPSIVSETVTSLLSELNLTHLSHTRLAQGLSGGERRRVSI 170

  Fly   161 GIQLVRDPVMLLLDEPTHGLDPLSAYLLISILSNTAKKTGCGILLSLEKPRSDVFPFLDRALFLC 225
            |:.|:.||..|||||||.|||..||:.:|.||.:.|......::||:.:|...:...:||.|.|.
plant   171 GLSLLHDPCFLLLDEPTSGLDSKSAFDVIHILKSIAVSRQRTVILSIHQPSFKILSIIDRLLLLS 235

  Fly   226 LGGVVYSGGTRAMLEYFHGIGFPCPQLENPLMYYL----------------CLSTVDRRSRDRFL 274
            .|.|||.|...::..:....||..|...|.|.|.:                .|.:::.|.:    
plant   236 KGTVVYHGRLDSLEGFLLFKGFTVPPQLNSLEYAMEILQELRESDGNTDATALPSIENRKQ---- 296

  Fly   275 ESSQQIEALVE-RFSRETPISDAPLNNMGSGKVPLAYGKPGELKVWVMLYLK---LLASTFSCGL 335
               ::.:::|. |.||.|.||            .||      .:.|.::|..   ||.:.....:
plant   297 ---REKQSIVRYRKSRITEIS------------LLA------RRFWKIIYRTRQLLLTNALEALV 340

  Fly   336 VGMKTLFLRLLLLPLALSILWAFYTDVGDDSHGFFTKNGMI---LNILGLSYGCGILTTISLFPI 397
            ||:               :|...|.::|....|...:.||.   |..|       :.:|....||
plant   341 VGL---------------VLGTIYINIGIGKAGIEKRFGMFAFTLTFL-------LSSTTETLPI 383

  Fly   398 W---RKKFSQDTPEGLYSGTTLLIAYNSVSIPFSAVSAVIASCVVYPLLLDVKYNNG-----TVF 454
            :   |....::|..|:|..::.::|...|.:|:..|.::|.|..||.|:       |     ..|
plant   384 FINERPILLRETSSGIYRLSSHILANTLVFLPYLFVISIIYSVSVYFLI-------GLCPTWQAF 441

  Fly   455 AYLLVALWSSFVLAEQLTIAFLLVVKVPFNAAIAVTYVLVISIALASGTVRSFKGL-QPWL 514
            .|.::.:|...::|... :.||..:...:....::..:|:.:..|.||...|.:.| :.||
plant   442 GYFVLVIWIILLMANSF-VLFLSSLAPNYITGTSLVTILLAAFFLFSGYFISKESLPKYWL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11069NP_651307.2 ABCG_White 15..233 CDD:213201 72/201 (36%)
CcmA 31..302 CDD:224054 88/287 (31%)
ABC2_membrane 364..515 CDD:304374 36/163 (22%)
ABCG8NP_200098.1 P-loop_NTPase 29..243 CDD:304359 72/201 (36%)
3a01204 44..584 CDD:273361 135/514 (26%)
ABC2_membrane 316..519 CDD:279410 47/222 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1022017at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48041
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.