DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11069 and Abca14

DIOPT Version :9

Sequence 1:NP_651307.2 Gene:CG11069 / 42976 FlyBaseID:FBgn0039244 Length:604 Species:Drosophila melanogaster
Sequence 2:XP_038957098.1 Gene:Abca14 / 365362 RGDID:1561491 Length:1691 Species:Rattus norvegicus


Alignment Length:233 Identity:64/233 - (27%)
Similarity:121/233 - (51%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NSALV-LKGVNLTVHSGEVMAILGSKGSGKRALLDVISRRADG---ATRGQVLLNGSPLSKALFQ 92
            ||.|: :|.::|.::.|::..:||..|:||...|.:::    |   .|:|:|.::|..:|..:.|
  Rat   544 NSTLMAVKDLSLNLYEGQITVLLGHNGAGKTTTLSILT----GLYLPTKGKVYISGYDISSDMVQ 604

  Fly    93 QR--CGYVTQSCTFVPGLTVAQTLHYTPTILSGYLKSSKVRQV---LADLALSQVAHKRVEYLNI 152
            .|  .|...|.....|.|||::.|::. .::.|...:::.|::   |....|.|.::...:.|:.
  Rat   605 VRKSLGLCPQDDLLFPLLTVSEHLYFY-CVIKGISSTNRPREIHRMLTSFGLLQKSNTMSKDLSG 668

  Fly   153 SEARRLAIGIQLVRDPVMLLLDEPTHGLDPLSAYLLISILSNTAKKTGCGILLSLEKPRSDVFPF 217
            ...|:|:|.|.|:.|..:::|||||.|:||:|...:..:|.: .||....:|.:.....:||.. 
  Rat   669 GMKRKLSIIIALIGDTKVVILDEPTSGMDPVSRRAIWDLLQH-YKKDRTILLTTHHMDEADVLG- 731

  Fly   218 LDRALFLCLGGVVYSGGTRAMLEYFHGIGFPCPQLENP 255
             ||...|.: ||:...|:...|:..:|:|:....::.|
  Rat   732 -DRIAILVM-GVLKCCGSSLFLKKLYGVGYHLVIVKTP 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11069NP_651307.2 ABCG_White 15..233 CDD:213201 59/209 (28%)
CcmA 31..302 CDD:224054 64/233 (27%)
ABC2_membrane 364..515 CDD:304374
Abca14XP_038957098.1 rim_protein <100..1681 CDD:130324 64/233 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.