DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11069 and Y45F10C.6

DIOPT Version :9

Sequence 1:NP_651307.2 Gene:CG11069 / 42976 FlyBaseID:FBgn0039244 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001023470.2 Gene:Y45F10C.6 / 3565462 WormBaseID:WBGene00044256 Length:118 Species:Caenorhabditis elegans


Alignment Length:84 Identity:17/84 - (20%)
Similarity:30/84 - (35%) Gaps:13/84 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 HGIGFPCPQLENPLMYYLCLSTVDRRSRDR-----------FLESSQQIEALVERFSRETPISDA 296
            :||......:|:.....|.|::|:|.....           |::|..:.|....:.:.:||....
 Worm    33 NGINLKVSIVESRGRVELRLTSVNRHETPNLTQFVFAIIVPFIQSPNEEEEDFHQVTLDTPPDRE 97

  Fly   297 PLNNMGSGKV--PLAYGKP 313
            .|.....|..  |:.|..|
 Worm    98 ELRTRRGGATLQPIIYAGP 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11069NP_651307.2 ABCG_White 15..233 CDD:213201
CcmA 31..302 CDD:224054 13/69 (19%)
ABC2_membrane 364..515 CDD:304374
Y45F10C.6NP_001023470.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.