DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11069 and Abca6

DIOPT Version :9

Sequence 1:NP_651307.2 Gene:CG11069 / 42976 FlyBaseID:FBgn0039244 Length:604 Species:Drosophila melanogaster
Sequence 2:XP_006247716.1 Gene:Abca6 / 303639 RGDID:1308998 Length:1630 Species:Rattus norvegicus


Alignment Length:643 Identity:139/643 - (21%)
Similarity:233/643 - (36%) Gaps:180/643 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FNGAGNSALVLKGVNLTVHSGEVMAILGSKGSGKRALLDVISRRADGATRGQVLLNGSPLSKAL- 90
            :.|.......|||:...|:..::.|:||..|:||.:||:::: .....|.|...:....||:.. 
  Rat   491 YKGKSGKVEALKGLFFDVYESQITAVLGHGGAGKSSLLNILN-GLSVPTSGLATVYNKNLSEMQD 554

  Fly    91 ---FQQRCGYVTQSCTFVPGLTVAQTLHYTPTILSGYLKSS---KVRQVLADLALSQVAHKRVEY 149
               .::..|...|.......|||.:.|.....| .|.:..|   :|:|:|::|.:..:..:..|:
  Rat   555 LKEIRKMIGVCPQHNVQFDALTVKENLTLFANI-KGIVPQSVAQEVQQILSELDMQTIQDELAEH 618

  Fly   150 LNISEARRLAIGIQLVRDPVMLLLDEPTHGLDPLSAYLLISILSNTAKKTGCGILLSLE-KPRSD 213
            |:..:.|:|..|:.::.||.:|||||||.||||.|...:...|..  ::....||.|.: ...:|
  Rat   619 LSEGQKRKLTFGVAILGDPRILLLDEPTAGLDPFSRQRVWGFLKE--RRADRVILFSTQFTDEAD 681

  Fly   214 VFPFLDRALFLCLGGVVYSGGTRAMLEYFHGIGF-----------------------PCPQL--- 252
            :  ..||.:.|. .|.:...|:...|:...|:|:                       |..:|   
  Rat   682 I--LADRKVILS-NGALKCTGSSVFLKRKWGLGYHLSLFMNETCDSEQLTSFINHHIPGAKLKAK 743

  Fly   253 -ENPLMYYLCL----------STVDRRSRDRFLESSQQIEALVERFSR--------------ETP 292
             :..|:|.|.|          |.:|:.|....:.....:..|.|.|..              ||.
  Rat   744 TKEKLVYTLPLEKTSKFPEFFSDLDKYSGQGLMNYEVSMSTLNEVFMNLEGEPSTTQDFEKGETL 808

  Fly   293 ISDAPLNNMGSGKVPLAYGKP--GELKVWVMLYLKLLASTFSCGLVGMKTLFLR------LLLLP 349
            .....||.|......|:..:.  ..:.:|.|..         |.:..::.|.||      |..||
  Rat   809 TDSDSLNEMEVAPPSLSKAQKTMSAMSLWRMQV---------CAIARLRVLKLRRERKAFLTFLP 864

  Fly   350 -LALSIL-----------------WAFYTDV-----GDDSHGFFTKNGMILN--------ILGLS 383
             |.:|::                 |.|.||:     |....|..|...:|.|        :..|.
  Rat   865 LLGISLIPLITEYMANALIEVKTNWEFKTDLYFLSPGQLPQGLRTSLLVINNTESNIEDFVQSLK 929

  Fly   384 YGCGILTTISLFPIWRKKFSQDTPEGLYSGTTLLIAYNSVSIPFSAV-SAVIASCVVYPLLLDVK 447
            :. .|:..:..|.      :::..|.|.....::::.......|||| :.....|  :|:|::| 
  Rat   930 HQ-NIVLEVDDFE------NRNATESLSYNGAIIVSGRQKDYRFSAVCNTKRLHC--FPILMNV- 984

  Fly   448 YNNG---------------TVFAYLLVALWSSFVLAEQLTIAFLLVVKVPFNAAIAVTYVLVISI 497
            .:||               .|.:..:|.:|.. :|...|:|.|:               |..:|.
  Rat   985 ISNGILRMLNHTQHIRLEEDVLSSGIVVVWFG-ILEASLSILFI---------------VCSVSP 1033

  Fly   498 ALASGTVRSFK----------GLQP---W----LQDNT-------KGTHTRYASSLLH 531
            .:|..::..||          ||.|   |    |.|.|       .|..|.|.:.|:|
  Rat  1034 HIAMSSISDFKKKADSQLWISGLYPSAYWCGQALVDITLLSGILLTGYITLYTTKLMH 1091

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11069NP_651307.2 ABCG_White 15..233 CDD:213201 58/213 (27%)
CcmA 31..302 CDD:224054 77/329 (23%)
ABC2_membrane 364..515 CDD:304374 35/191 (18%)
Abca6XP_006247716.1 ABC2_membrane_3 35..420 CDD:289468
ABC2_membrane_4 220..409 CDD:289500
CcmA 480..795 CDD:224054 74/310 (24%)
ABC_subfamily_A 482..705 CDD:213230 59/220 (27%)
ABC2_membrane_3 859..1171 CDD:289468 53/259 (20%)
ABC2_membrane_4 1007..1178 CDD:289500 23/101 (23%)
CcmA 1279..1605 CDD:224054
ABC_subfamily_A 1300..1514 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.