DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31121 and ABCG13

DIOPT Version :10

Sequence 1:NP_733058.1 Gene:CG31121 / 42975 FlyBaseID:FBgn0051121 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_175557.1 Gene:ABCG13 / 841571 AraportID:AT1G51460 Length:678 Species:Arabidopsis thaliana


Alignment Length:124 Identity:25/124 - (20%)
Similarity:51/124 - (41%) Gaps:18/124 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IKNVKESNVY-QSVETKVG--EITTVVTSAPIYQKTESAIKTTAGKTTSVIGGIAGKMTQKLTEM 153
            |.|..|..:| ..||..:.  |..|.:.|...:|:    :|:...|.         |..:...|:
plant    25 IVNCSEQEIYAMLVECNMNADEAITRLLSQDSFQE----VKSKRDKK---------KEAKDALEI 76

  Fly   154 KQSDSFRSFEERVGSAYENVRSKVSSRSSSVQSLSDIQNDERRSSVTTPTAIPEEKPIP 212
            ::......:.:....:.:|..:|::|..:|  ::..|:|....||:.:..:..|.|.:|
plant    77 QRLSGRNQYHKSKNGSDQNGGNKLNSYGTS--NVQRIRNHLAGSSLNSAISNVETKRVP 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31121NP_733058.1 3a01204 319..818 CDD:273361
ABCG13NP_175557.1 3a01204 27..627 CDD:273361 24/122 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.