DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31121 and Y45F10C.6

DIOPT Version :9

Sequence 1:NP_733058.1 Gene:CG31121 / 42975 FlyBaseID:FBgn0051121 Length:911 Species:Drosophila melanogaster
Sequence 2:NP_001023470.2 Gene:Y45F10C.6 / 3565462 WormBaseID:WBGene00044256 Length:118 Species:Caenorhabditis elegans


Alignment Length:82 Identity:18/82 - (21%)
Similarity:24/82 - (29%) Gaps:38/82 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 DSSDNETT-------------RSRV-----------PPNLRKY-------------RSESDFRAI 191
            :..|.:||             |.||           .|||.::             ..|.||..:
 Worm    24 NQGDTQTTKNGINLKVSIVESRGRVELRLTSVNRHETPNLTQFVFAIIVPFIQSPNEEEEDFHQV 88

  Fly   192 G-GMPHSRPESRAQIGG 207
            . ..|..|.|.|.:.||
 Worm    89 TLDTPPDREELRTRRGG 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31121NP_733058.1 P-loop_NTPase 319..518 CDD:304359
cbiO 319..491 CDD:130234
ABC2_membrane 621..809 CDD:279410
Y45F10C.6NP_001023470.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.