DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CCNQ

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_689487.2 Gene:CCNQ / 92002 HGNCID:28434 Length:248 Species:Homo sapiens


Alignment Length:225 Identity:46/225 - (20%)
Similarity:86/225 - (38%) Gaps:56/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 FQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKI 364
            |:|:.:.|:....|.:|  ..|||.       ..|.......:..::..:.:.:...::|||.|:
Human    28 FRVARFIMEAGVKLGMR--SIPIAT-------ACTIYHKFFCETNLDAYDPYLIAMSSIYLAGKV 83

  Fly   365 VDLYL-CREVIN---------KEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVR 419
            .:.:| .|::||         .|.|:|            |.|...|             .|.:|:
Human    84 EEQHLRTRDIINVSNRYFNPSGEPLEL------------DSRFWEL-------------RDSIVQ 123

  Fly   420 MERETLRVIKYDLGIPLSYRFLRRYA--------RCAKVPMPTLTLARYILELSLMDYANISFSD 476
            .|...|||:::.:.....:::|..|.        |.:....|....|..:|..|......:.|..
Human   124 CELLMLRVLRFQVSFQHPHKYLLHYLVSLQNWLNRHSWQRTPVAVTAWALLRDSYHGALCLRFQA 188

  Fly   477 SQMASAALFMALRMHG--GPGQL--DKQTW 502
            ..:|.|.|::||:::|  .|.::  :|..|
Human   189 QHIAVAVLYLALQVYGVEVPAEVEAEKPWW 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 26/134 (19%)
Cyclin_C 435..555 CDD:281044 17/80 (21%)
CCNQNP_689487.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
CYCLIN_CCNM_CCNQ_rpt1 26..135 CDD:410237 29/140 (21%)
CYCLIN_CCNM_CCNQ_rpt2 140..243 CDD:410238 17/79 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.