DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CCNG1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001350944.1 Gene:CCNG1 / 900 HGNCID:1592 Length:295 Species:Homo sapiens


Alignment Length:350 Identity:67/350 - (19%)
Similarity:132/350 - (37%) Gaps:95/350 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LEDVSSCDSMRLSGNFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRK 294
            :|.:::.||.:|      ..:.:|.|:|::..||:...|.|.|:|..                  
Human     2 IEVLTTTDSQKL------LHQLNALLEQESRCQPKVCGLRLIESAHD------------------ 42

  Fly   295 NWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLY 359
                                             ..:.:|..:|...|..::.:.:.|..:.||..
Human    43 ---------------------------------NGLRMTARLRDFEVKDLLSLTQFFGFDTETFS 74

  Fly   360 LAVKIVDLYLCREVINKEKLQLLGAAAFFIACK--YDERQPPLIEDFLYICDGAYNHDELVRMER 422
            |||.::|.:|.:..:..:.|..:|.:.|::|.|  .:||..||..|.:.|....:...:|:|||:
Human    75 LAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEK 139

  Fly   423 ETLRVIKYDLGIPLSYRFLRRYARCAKVPMP-----TLTLARYILELSLMDYANISFSDSQMASA 482
            ..|..:.:.:....:::||:.|....:..:|     ::...|...:|... :..|.||.::.:..
Human   140 IVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKAC-HCRIIFSKAKPSVL 203

  Fly   483 AL-FMALRMHG--------GPGQLDKQTWTSTLIYYTGYQLADFAEIV----TALNAGLHRKPRA 534
            || .:||.:..        |...|.|.:      ...|..|..:.|:|    |..::....||..
Human   204 ALSIIALEIQAQKCVELTEGIECLQKHS------KINGRDLTFWQELVSKCLTEYSSNKCSKPNV 262

  Fly   535 ----------TIKTIRNKYSHKIFH 549
                      |.:.:::.| ::|.|
Human   263 QKLKWIVSGRTARQLKHSY-YRITH 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 27/126 (21%)
Cyclin_C 435..555 CDD:281044 26/142 (18%)
CCNG1NP_001350944.1 CYCLIN_CCNG1 51..148 CDD:410286 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.