DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CCNA1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_003905.1 Gene:CCNA1 / 8900 HGNCID:1577 Length:465 Species:Homo sapiens


Alignment Length:361 Identity:128/361 - (35%)
Similarity:188/361 - (52%) Gaps:42/361 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 PPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALE--DVSSCDSMRLSGNFEAARRRSAKLQQ 257
            ||....|.|.....:|.::   .|:     :||..||  |..|| |:|....||..    .::..
Human   115 PPAGKKALPDCGVQEPPKQ---GFD-----IYMDELEQGDRDSC-SVREGMAFEDV----YEVDT 166

  Fly   258 KTEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEF-- 320
            .|.:.....||.....:|..|  ...:..:.||..... .|...|:.||.:|:.||  ||||.  
Human   167 GTLKSDLHFLLDFNTVSPMLV--DSSLLSQSEDISSLG-TDVINVTEYAEEIYQYL--REAEIRH 226

  Fly   321 -PIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYL-CREVINKEKLQLLG 383
             |.|.||.:|..:|..|||:||||:|||.|.::|..|||||||..:|.:| |..|: :.||||:|
Human   227 RPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVL-RGKLQLVG 290

  Fly   384 AAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCA 448
            .||..:|.||:|..||.:::|:||.|..|...:|::||...|:|:.:||.:|.:.:||.:|.|..
Human   291 TAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQ 355

  Fly   449 KVPMPTLTLARYILELSLMDYAN--ISFSDSQMASAALFMALRMHGGPGQLDKQTWTSTLIYYTG 511
            .|.:.|..||:|:.||||:: |:  :.:..|.:|:||..:|      ...::|..|..||..:||
Human   356 GVCVRTENLAKYVAELSLLE-ADPFLKYLPSLIAAAAFCLA------NYTVNKHFWPETLAAFTG 413

  Fly   512 YQLADFAEIVTALNAGLHRK----PRATIKTIRNKY 543
            |.|   :|||..|:. ||:.    |....:.||.||
Human   414 YSL---SEIVPCLSE-LHKAYLDIPHRPQQAIREKY 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 60/128 (47%)
Cyclin_C 435..555 CDD:281044 39/115 (34%)
CCNA1NP_003905.1 Cyclin_N2 71..>145 CDD:293109 10/37 (27%)
Cyclin_N 214..340 CDD:278560 60/128 (47%)
Cyclin_C 342..459 CDD:281044 39/115 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.