DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CLN1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_013926.1 Gene:CLN1 / 855239 SGDID:S000004812 Length:546 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:29/165 - (17%)
Similarity:66/165 - (40%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 VSHYAMDIFNYLKVREA----EFPIADYMPR-QIHLTTWMRTLLVDWMVEVQETFELNHETLYLA 361
            :..|..:|...:.|:.:    :..:.|..|. ..|.|   |..:|.::.::.....:::...:.|
Yeast    35 IQEYHEEISQNVLVQSSKTKPDIKLIDQQPEMNPHQT---REAIVTFLYQLSVMTRVSNGIFFHA 96

  Fly   362 VKIVDLYLCREVINKEKLQLLGAAAFFIACK-----------------------YDERQPPLIED 403
            |:..|.|..:.|:.|::.:|:.....::|.|                       ....:.|.:.:
Yeast    97 VRFYDRYCSKRVVLKDQAKLVVGTCLWLAAKTWGGCNHIINNVSIPTGGRFYGPNPRARIPRLSE 161

  Fly   404 FLYICDGAYNHDE--LVRMERETLRVIKYDLGIPL 436
            .::.|.|:...||  .::|||..|..:.:|:..|:
Yeast   162 LVHYCGGSDLFDESMFIQMERHILDTLNWDVYEPM 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 27/154 (18%)
Cyclin_C 435..555 CDD:281044 1/2 (50%)
CLN1NP_013926.1 COG5024 31..539 CDD:227357 29/165 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.