DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CLN3

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_009360.1 Gene:CLN3 / 851191 SGDID:S000000038 Length:580 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:29/147 - (19%)
Similarity:60/147 - (40%) Gaps:13/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 VEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFE 352
            :.:::....|..|::||....::|......           |..:...||.|:.|:::.......
Yeast    70 ISEYNNDQLDHYFRLSHTERPLYNLTNFNS-----------QPQVNPKMRFLIFDFIMYCHTRLN 123

  Fly   353 LNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKY--DERQPPLIEDFLYICDGAYNHD 415
            |:..||:|...|:|.|..|.:|.....|||...|.:|:.|:  .:.:...::....:|...|:..
Yeast   124 LSTSTLFLTFTILDKYSSRFIIKSYNYQLLSLTALWISSKFWDSKNRMATLKVLQNLCCNQYSIK 188

  Fly   416 ELVRMERETLRVIKYDL 432
            :...||....:.:.:.:
Yeast   189 QFTTMEMHLFKSLDWSI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 25/127 (20%)
Cyclin_C 435..555 CDD:281044
CLN3NP_009360.1 COG5024 35..576 CDD:227357 29/147 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.