DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYCB2;4

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001323249.1 Gene:CYCB2;4 / 843964 AraportID:AT1G76310 Length:459 Species:Arabidopsis thaliana


Alignment Length:523 Identity:122/523 - (23%)
Similarity:209/523 - (39%) Gaps:139/523 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DEEQSGV-GKKPTAQQLQALMDAKKQENLSVNVFGASKMTTRASSKVEDSVENCHKVLDKLEEAL 158
            ||.:.|| |  |..:|...|...|        |...:..|.||.|.:..::             :
plant     5 DENRHGVIG--PMNRQQGGLRGGK--------VIPTNGQTRRALSNINKNI-------------I 46

  Fly   159 ARPKPRPKAV--PAAKKTVLGEVQLPAMPNPMQIPVLLPPTHNLAA----------------PQV 205
            ..| ..|.||  |..:|..:...::|      .:||..|.|...||                |.:
plant    47 GAP-VYPCAVKRPFTEKNGICNKKIP------PVPVHRPVTRKFAAQLAENNLQIHKEETKKPDL 104

  Fly   206 AAVKPVRRI-----SNDFNK------TEDSLYMSALEDVSSCDSMRL--SGNFEAARRRSAKLQQ 257
            .:.:.:.||     ..|||:      ||     :.||::...:.:.:  |.:.:|          
plant   105 ISNEALDRIITDVEEGDFNEPMFVQHTE-----AMLEEIDKMEGIEMQDSNDIDA---------- 154

  Fly   258 KTEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPI 322
                                     .|.|.|.|.|..:.::|..|..|..||:.:.|..|....:
plant   155 -------------------------EVEESVMDIDSCDKNNPLSVVEYINDIYCFYKKNECRSCV 194

  Fly   323 -ADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLC-REVINKEKLQLLGAA 385
             .:||..|..:...||.:|.||::||...|||..|||||.:.::|.:|. .:.|.::||||:|..
plant   195 PPNYMENQHDINERMRGILFDWLIEVHYKFELMEETLYLTINLIDRFLAVHQHIARKKLQLVGVT 259

  Fly   386 AFFIACKYDERQPPLIEDFLYICDGAYNHDELVRM----------------------------ER 422
            |..:||||:|...|:::|.:.|.|.||...|::.|                            |:
plant   260 AMLLACKYEEVSVPVVDDLILISDKAYTRTEILDMVKSFTKSCPDYNHGCSALYVDDHYCVLQEK 324

  Fly   423 ETLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMA 487
            .....::::..:|..|.|:||:.:.|:.......|:.:::||.|::|..:.::.||:|::|::.|
plant   325 LMANTLQFNFCLPTPYVFMRRFLKAAQSDKKLELLSFFMIELCLVEYEMLQYTPSQLAASAIYTA 389

  Fly   488 LRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKP-RATIKTIRNKYSHKIFHEV 551
            .....|     .:.|:.|..:::||......|....: .|||.|. ...:..:..||:...|...
plant   390 QSTLKG-----YEDWSKTSEFHSGYTEEALLECSRKM-VGLHHKAGTGKLTGVHRKYNTSKFGYA 448

  Fly   552 AKV 554
            |::
plant   449 ARI 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 45/154 (29%)
Cyclin_C 435..555 CDD:281044 30/121 (25%)
CYCB2;4NP_001323249.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.