DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYCA3;2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_564499.3 Gene:CYCA3;2 / 841124 AraportID:AT1G47210 Length:372 Species:Arabidopsis thaliana


Alignment Length:318 Identity:115/318 - (36%)
Similarity:176/318 - (55%) Gaps:23/318 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 AKLQQKTE-QQPQPLLLTLP----ETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNY 312
            |.|.||.| |:|:..|...|    ::||..::.:    |...|.|.:: |||.....|..||:.|
plant    50 ANLNQKKETQKPKRNLKPPPAKQIKSAPVAIIDL----ESKSDIDSRS-DDPQMCGPYVADIYEY 109

  Fly   313 LK---VREAEFPIADYMPR-QIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREV 373
            |:   |:..:.|:.||:.: |..:|..||.:||||:|||.|.::|..|||||.|..:|.:|..:.
plant   110 LRQLEVKPKQRPLPDYIEKVQKDVTPSMRGVLVDWLVEVAEEYKLGSETLYLTVSHIDRFLSLKT 174

  Fly   374 INKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSY 438
            :||:||||:|.:|..||.||:|..||.::||.||.|..::..::|:||.:.|..::::||.|...
plant   175 VNKQKLQLVGVSAMLIASKYEEISPPKVDDFCYITDNTFSKQDVVKMEADILLALQFELGRPTIN 239

  Fly   439 RFLRRYARCA----KVPMPTL-TLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQLD 498
            .|:||:.|.|    |||...| .|..|:.|||::||..:.|..|.:|::|:|:| |....|.|  
plant   240 TFMRRFTRVAQDDFKVPHLQLEPLCCYLSELSILDYKTVKFVPSLLAASAVFLA-RFIIRPKQ-- 301

  Fly   499 KQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTIRNKYSHKIFHEVAKVPL 556
             ..|...|..||.|:.||....|..::.....:....::.:|.||.|..|..||.:|:
plant   302 -HPWNQMLEEYTKYKAADLQVCVGIIHDLYLSRRGGALQAVREKYKHHKFQCVATMPV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 53/128 (41%)
Cyclin_C 435..555 CDD:281044 41/124 (33%)
CYCA3;2NP_564499.3 COG5024 <88..352 CDD:227357 100/268 (37%)
Cyclin_N 105..234 CDD:365896 53/128 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2906
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.