DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYCA1;1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_175077.1 Gene:CYCA1;1 / 841014 AraportID:AT1G44110 Length:460 Species:Arabidopsis thaliana


Alignment Length:523 Identity:153/523 - (29%)
Similarity:241/523 - (46%) Gaps:86/523 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KRKADHSPIKNDKIKRSALGNLTNNVKIMTLHPAQDEEQ---SGVGKKPTAQQLQALMDAKKQEN 121
            :|.:..|..|:...||.|..:..|:||:|   ||..:::   |.:..:..|.:||. .|:....|
plant     8 RRSSFSSSTKSSLAKRQAPSSSENSVKLM---PAMTKKRAPLSNITNQKIASRLQN-SDSVHCSN 68

  Fly   122 LSVNVFGASKMTTRA--SSKVEDSVENCHKVLDKLEEALARPKPRPKAVPAAKKTVLGEVQLPAM 184
            .|..:..|..:...|  ||.::.|:.. |||                 ..:..|:..|.|.:...
plant    69 KSAKLKIAPSVCVNASFSSNLQQSIVP-HKV-----------------ASSPSKSDDGSVSMDET 115

  Fly   185 PNPMQIPVLLPPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALEDVSSCDSMRLSGNFEAAR 249
            .:         .:.:..:||      |..|.||......|:...||.::....:.....|:.:  
plant   116 RS---------SSDSYKSPQ------VEYIENDDVSAVVSIERKALSNLFITPNSETIDNYCS-- 163

  Fly   250 RRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLK 314
                          :.:|..:.:...:|:|.|          |..| .||...:.:|.||:.:|:
plant   164 --------------RDVLSDMKKMDKNQIVNI----------DSNN-GDPQLCATFACDIYKHLR 203

  Fly   315 VREA-EFPIADYMPR-QIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKE 377
            ..|| :.|..|||.| |..:.:.||.:||||::||.|.:.|..|||||.|..:|.||...||:::
plant   204 ASEAKKRPDVDYMERVQKDVNSSMRGILVDWLIEVSEEYRLVPETLYLTVNYIDRYLSGNVISRQ 268

  Fly   378 KLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLR 442
            ||||||.|...||.||:|...|.:|:|.||.|..|..||::.||.:.|..:|:::..|.:..|||
plant   269 KLQLLGVACMMIAAKYEEICAPQVEEFCYITDNTYLKDEVLDMESDVLNYLKFEMTAPTTKCFLR 333

  Fly   443 RYARCA----KVPMPTL-TLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQLD--KQ 500
            |:.|.|    :.|:..| .:|.||.||||::|..:|.|.|.:|::|:|:|..:      ||  ::
plant   334 RFVRAAHGVHEAPLMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLAKYI------LDPTRR 392

  Fly   501 TWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTIRNKYSHKIFHEVAK--VPLLTNQELF 563
            .|.|||.:||.|:..:....|..|.........:|:..:|.|||...:..|||  .|.:..||.|
plant   393 PWNSTLQHYTQYKAMELRGCVKDLQRLCSTAHGSTLPAVREKYSQHKYKFVAKKFCPSVIPQEFF 457

  Fly   564 QGN 566
            ..:
plant   458 NNS 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 57/126 (45%)
Cyclin_C 435..555 CDD:281044 43/128 (34%)
CYCA1;1NP_175077.1 CYCLIN_AtCycA_like_rpt1 187..322 CDD:410265 60/134 (45%)
CYCLIN_AtCycA-like_rpt2 326..440 CDD:410210 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2906
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.