DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYCB1;5

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001320187.1 Gene:CYCB1;5 / 840348 AraportID:AT1G34460 Length:498 Species:Arabidopsis thaliana


Alignment Length:416 Identity:102/416 - (24%)
Similarity:172/416 - (41%) Gaps:82/416 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KQENLSVNVFGASKMTTRASSKVEDSVENCHKVLDKLEEALARPKPRPKAVPAAKKTVLGEV-QL 181
            |:.|||      :.|.|||:  :.:.|... .::|.|       |.:.|......:..||:: .|
plant   105 KRTNLS------AIMATRAN--IPEQVRGA-PLVDGL-------KIQNKNGAVKNRRALGDIGNL 153

  Fly   182 PAMP----NPMQIPVLLPPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALEDVSSCDSMRLS 242
            .::|    ...|.|:..|.|.:..|..:|..:..|:..|..||      :.||    ...|..|:
plant   154 VSVPGVQGGKAQPPINRPITLSFRAQLLANAQLERKPINGDNK------VPAL----GPKSQPLA 208

  Fly   243 GNFEAARRRSAKLQQKTEQQPQPL-LLTLPETAPSQ----VVPIPPVPEEVEDFDRKNWDDPFQV 302
            .....|:|...|.....:||.:|: ::.....|.|:    :|..|    ::.|.|..:.|:....
plant   209 ARNPEAQRAVQKKNLVVKQQTKPVEVIETKRNAQSKAACGIVNKP----KILDIDESDKDNHVAA 269

  Fly   303 SHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDL 367
            ..|..|::::.|..|.|.....||..|..:...||.:|:||::||...||||.|||||.|.|:|.
plant   270 VEYVDDMYSFYKEVEKESQPKMYMHIQTEMNEKMRAILIDWLLEVHIKFELNLETLYLTVNIIDR 334

  Fly   368 YLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDL 432
            :|..:.:.|.:||                    :.|.:|:.|.||:..:::.|::..|..:::.|
plant   335 FLYVKAVPKRELQ--------------------VNDLVYVTDNAYSSRQILVMKKAILGNLEWYL 379

  Fly   433 GIPLSYRFLRRYARCAKVPMPTL------------TLARYILELSLMDYANISFSDS-----QMA 480
            .||..|.||..:.: |.:..|.:            |.:..|..||...:.:|..||.     .:.
plant   380 TIPTQYVFLFCFIK-ASISDPEVLHVQKKNLQASKTKSFSIQVLSFSSHKSIVKSDQFCKKFNLC 443

  Fly   481 SAALFMALRMHGGPGQLDKQTWTSTL 506
            .....:|...|.|    :.:.|..|:
plant   444 QEVTALASEFHLG----NCEAWRETV 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 37/124 (30%)
Cyclin_C 435..555 CDD:281044 18/89 (20%)
CYCB1;5NP_001320187.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.