DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and AT1G20590

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001319051.1 Gene:AT1G20590 / 838648 AraportID:AT1G20590 Length:265 Species:Arabidopsis thaliana


Alignment Length:273 Identity:67/273 - (24%)
Similarity:123/273 - (45%) Gaps:40/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 NYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFE-LNHETLYL------AVKIVDLY 368
            ||::.:..:..|..:. ||......|..:.|..:|..:.||. .|.:..|.      .:.::|.:
plant     6 NYIEHQNKKKTIIIFF-RQFKKQKPMLRMGVHLVVINKNTFNFFNRQNNYFNSGKTKKIFVIDRF 69

  Fly   369 LCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLG 433
            |....|.::||||:|..|..:||||:|...|:::|.:.|.|.||:..|::.||:.....::::..
plant    70 LAVHQIVRKKLQLVGVTALLLACKYEEVSVPVVDDLILISDKAYSRREVLDMEKLMANTLQFNFS 134

  Fly   434 IPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQLD 498
            :|..|.|::|:.:.|:.......|:.:::||.|::|..:.:..|::|::|::.|.....|     
plant   135 LPTPYVFMKRFLKAAQSDKKLEILSFFMIELCLVEYEMLEYLPSKLAASAIYTAQCTLKG----- 194

  Fly   499 KQTWTSTLIYYTGY---QLADFAEIVTALNAGLHRKPRATIKTIRNKYSHKIFHEVAKVPLLTNQ 560
            .:.|:.|..::|||   ||...|..:.|                        ||..|....||..
plant   195 FEEWSKTCEFHTGYNEEQLLACARKMVA------------------------FHHKAGTGKLTGS 235

  Fly   561 ELFQGNLDLNESN 573
            .....:..|.|.|
plant   236 TTHLSSFMLQEVN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 35/128 (27%)
Cyclin_C 435..555 CDD:281044 27/122 (22%)
AT1G20590NP_001319051.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.